close all open/close all

CDS information : Polk_00290


close this sectionLocation

Organism
StrainTü6028
Entry namePolyketomycin
Contig
Start / Stop / Direction37,159 / 37,938 / + [in whole cluster]
37,159 / 37,938 / + [in contig]
Location37159..37938 [in whole cluster]
37159..37938 [in contig]
TypeCDS
Length780 bp (259 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.1 general function
Productputative oxidoreductase
Product (GenBank)PokT1
Gene
Gene (GenBank)pokT1
EC number
Keyword
Note
Note (GenBank)
  • putative ketoreductase
Reference
ACC
PmId
[19266534] Organisation of the biosynthetic gene cluster and tailoring enzymes in the biosynthesis of the tetracyclic quinone glycoside antibiotic polyketomycin. (Chembiochem. , 2009)
Related Reference
ACC
P71079
PmId
[11007778] The enoyl-[acyl-carrier-protein] reductases FabI and FabL from Bacillus subtilis. (J Biol Chem. , 2000)

close this sectionSequence

selected fasta
>putative oxidoreductase [PokT1]
MSEPHSRSEVAPLPGLKGRSALVIGGTRGVGRAVTEKLAVSGCDVVATFAHSAEDAGTLL
ADLKDTPGSLETLRGDARRAETLPEAMRHVRERHGRLDILVHAAASAHPMPVLGMRLTEV
YADTATALVPLAASAGPAADLLSEGGRIIVVSASVARGVAPHMVSLGVAKAALESLTRFV
AVELADRGVTVNAVSASKLDKGADTPRPEVARAIGARTPAGRLATPRDVADTVALLCLPE
AQWITGHVVSADGGLSLLA
selected fasta
>putative oxidoreductase [PokT1]
GTGTCGGAACCGCACTCGCGCAGCGAAGTAGCGCCGCTGCCAGGCCTGAAGGGCAGGAGC
GCCCTCGTCATCGGCGGGACGCGCGGAGTGGGCCGGGCCGTCACCGAGAAGCTGGCCGTG
TCGGGATGCGACGTCGTCGCGACGTTCGCCCACTCCGCGGAGGACGCCGGGACACTGCTC
GCGGATCTGAAGGACACGCCCGGCAGCCTGGAGACGCTGCGCGGCGACGCGCGCCGGGCC
GAGACGCTGCCCGAGGCGATGCGCCACGTGCGTGAGCGGCACGGTCGGCTCGACATCCTG
GTCCACGCCGCCGCCTCGGCGCACCCCATGCCGGTCCTCGGCATGCGTCTGACGGAGGTG
TACGCCGACACGGCGACCGCGCTGGTGCCGCTCGCCGCCTCCGCGGGGCCCGCGGCGGAC
CTGCTGTCCGAGGGCGGCCGGATCATCGTCGTCTCGGCGAGCGTCGCCCGCGGTGTGGCT
CCCCACATGGTCAGCCTCGGCGTCGCCAAGGCCGCCCTGGAGAGCCTGACACGCTTCGTG
GCCGTGGAACTGGCCGACCGCGGTGTGACCGTCAACGCGGTCTCCGCGTCCAAGCTCGAC
AAGGGCGCCGACACCCCGCGCCCCGAGGTCGCCCGCGCGATCGGTGCCCGCACCCCCGCG
GGACGCCTCGCCACACCCCGGGACGTCGCCGACACCGTGGCGCTGCTCTGCCTGCCCGAG
GCCCAGTGGATCACCGGCCACGTGGTGTCCGCCGACGGCGGCCTGAGCCTGCTGGCCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR002347 Glucose/ribitol dehydrogenase (Family)
 [20-37]  2.60000517657733e-23 PR00081 [95-106]  2.60000517657733e-23 PR00081 [140-156]  2.60000517657733e-23 PR00081 [166-185]  2.60000517657733e-23 PR00081 [187-204]  2.60000517657733e-23 PR00081 [219-239]  2.60000517657733e-23 PR00081
PR00081   GDHRDH
IPR016040 NAD(P)-binding domain (Domain)
 [15-257]  2.59999999999998e-55 G3DSA:3.40.50.720
G3DSA:3.40.50.720   NAD(P)-bd
SignalP No significant hit
TMHMM No significant hit