close all open/close all

CDS information : Polk_00300


close this sectionLocation

Organism
StrainTü6028
Entry namePolyketomycin
Contig
Start / Stop / Direction37,950 / 39,179 / + [in whole cluster]
37,950 / 39,179 / + [in contig]
Location37950..39179 [in whole cluster]
37950..39179 [in contig]
TypeCDS
Length1,230 bp (409 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.3 modification reduction
Productputative oxidoreductase
Product (GenBank)PokO1
Gene
Gene (GenBank)pokO1
EC number
Keyword
Note
Note (GenBank)
  • monooxygenase
Reference
ACC
PmId
[19266534] Organisation of the biosynthetic gene cluster and tailoring enzymes in the biosynthesis of the tetracyclic quinone glycoside antibiotic polyketomycin. (Chembiochem. , 2009)
Related Reference
ACC
Q3S8R0
NITE
Oxtet_00060
PmId
[18422316] Identifying the minimal enzymes required for anhydrotetracycline biosynthesis. (J Am Chem Soc. , 2008)
[19472250] Identification of OxyE as an ancillary oxygenase during tetracycline biosynthesis. (Chembiochem. , 2009)
ACC
Q70DW2
NITE
Resis_00160
PmId
[17090047] The boat-shaped polyketide resistoflavin results from re-facial central hydroxylation of the discoid metabolite resistomycin. (J Am Chem Soc. , 2006)

close this sectionSequence

selected fasta
>putative oxidoreductase [PokO1]
MEEHTRTDVCVVGGGPAGMTLALLLLRSGARVTVVERSSSLSREYRGEILQPGGLAVLDE
IGVLKGATDRGAHVLERFRLVEHGRVLMSFDYRRLQSPYNYLLSLPQAHLLAELLDRCQE
FPEFRYVVARVNGLIREGDAVRGVYAKAQDVTHTVRAACVVAADGRHSQVRRLAGIDHVR
QDVFDQDVVWFRLPATERLGEVMVNRAGGNPVLAYDSHPGAVQMGWTLPKGEWKRLAPLG
IGEVRRRITAATPQFADRVEGALRSFADVSLLDVFGAAAERWTGDGLVLIGDAAHTHGPL
GAQGINLAVQDAALLHPILLAAVTDGDVSAARLGEFERIRRPHIKAVMKFQAVQSRMMLS
ADSLATFLRPKLARVVMRTPIGAKFTQRIAFGAPGIRVADNLFTVNEKE
selected fasta
>putative oxidoreductase [PokO1]
ATGGAAGAACACACTCGCACGGACGTCTGCGTCGTCGGTGGCGGCCCCGCGGGCATGACC
CTGGCACTCCTGCTGCTGCGGTCCGGCGCACGCGTCACCGTCGTCGAGCGCAGCTCCTCG
CTCAGCCGCGAGTACCGCGGCGAGATCCTCCAGCCCGGCGGCCTCGCCGTCCTCGACGAG
ATCGGTGTCCTCAAGGGCGCCACCGACCGCGGCGCACACGTCCTGGAGCGGTTCCGGCTG
GTCGAGCACGGTCGCGTGCTGATGTCCTTCGACTACCGCAGGCTCCAGTCCCCGTACAAC
TACCTGCTCAGCCTGCCCCAGGCGCATCTGCTCGCCGAACTCCTGGACCGTTGCCAGGAG
TTCCCGGAGTTCCGCTACGTGGTGGCGCGGGTCAACGGCCTGATCCGGGAGGGCGACGCC
GTACGCGGTGTGTACGCCAAGGCCCAGGACGTCACGCACACCGTGCGCGCCGCCTGTGTG
GTCGCGGCGGACGGGCGCCACTCACAGGTCCGCCGGCTCGCCGGCATCGACCACGTCCGC
CAGGACGTCTTCGACCAGGACGTGGTCTGGTTCCGGCTGCCCGCGACGGAGCGTCTCGGC
GAAGTCATGGTGAACCGCGCCGGAGGCAACCCCGTGCTCGCCTACGACTCCCACCCGGGC
GCGGTGCAGATGGGCTGGACCCTGCCCAAGGGGGAGTGGAAGCGCCTGGCCCCGCTCGGC
ATCGGCGAGGTGCGCCGCAGGATCACCGCGGCGACCCCGCAGTTCGCCGACCGGGTCGAG
GGGGCGTTGCGCAGCTTCGCCGACGTCTCGCTCCTCGACGTGTTCGGCGCCGCCGCCGAG
CGGTGGACCGGCGACGGCCTCGTCCTCATCGGCGACGCCGCCCACACGCACGGCCCGCTC
GGCGCCCAGGGCATCAATCTCGCCGTCCAGGACGCCGCGCTGCTCCACCCGATCCTGCTC
GCCGCCGTCACGGACGGCGATGTGAGCGCGGCGCGGCTCGGAGAGTTCGAGAGGATCCGC
AGGCCGCACATCAAGGCCGTCATGAAGTTCCAGGCCGTGCAGAGCCGGATGATGCTCTCC
GCCGACAGCCTGGCCACCTTCCTGCGTCCCAAGCTCGCCCGAGTGGTGATGCGCACCCCG
ATCGGCGCCAAGTTCACCCAGCGGATCGCCTTCGGAGCCCCGGGCATCCGCGTCGCCGAC
AACCTCTTCACCGTCAACGAGAAAGAGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR002938 Monooxygenase, FAD-binding (Domain)
 [6-350]  1.29999999999998e-48 PF01494
PF01494   FAD_binding_3
IPR003042 Aromatic-ring hydroxylase-like (Domain)
 [8-30]  1.50000306971104e-22 PR00420 [156-171]  1.50000306971104e-22 PR00420 [284-299]  1.50000306971104e-22 PR00420 [299-315]  1.50000306971104e-22 PR00420
PR00420   RNGMNOXGNASE
SignalP
 [1-30]  0.365 Signal
Eukaryota   
TMHMM No significant hit