close all open/close all

CDS information : Polk_00310


close this sectionLocation

Organism
StrainTü6028
Entry namePolyketomycin
Contig
Start / Stop / Direction39,186 / 39,971 / + [in whole cluster]
39,186 / 39,971 / + [in contig]
Location39186..39971 [in whole cluster]
39186..39971 [in contig]
TypeCDS
Length786 bp (261 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.4 other modification
Productputative cyclase
Product (GenBank)PokC2
Gene
Gene (GenBank)pokC2
EC number
Keyword
  • 2nd and 3rd ring
Note
Note (GenBank)
  • putative cyclase
Reference
ACC
PmId
[19266534] Organisation of the biosynthetic gene cluster and tailoring enzymes in the biosynthesis of the tetracyclic quinone glycoside antibiotic polyketomycin. (Chembiochem. , 2009)
Related Reference
ACC
Q9L4U2
NITE
Acla_00250
PmId
[12715874] Studies on a second and third ring cyclization in anthracycline biosynthesis. (J Antibiot (Tokyo). , 2003)
ACC
Q9RN54
NITE
Nogl_00250
PmId
[11683270] The entire nogalamycin biosynthetic gene cluster of Streptomyces nogalater: characterization of a 20-kb DNA region and generation of hybrid structures. (Mol Genet Genomics. , 2001)
[12715874] Studies on a second and third ring cyclization in anthracycline biosynthesis. (J Antibiot (Tokyo). , 2003)
ACC
O68500
NITE
Adria_00160
PmId
[9573189] The Streptomyces peucetius dpsY and dnrX genes govern early and late steps of daunorubicin and doxorubicin biosynthesis. (J Bacteriol. , 1998)
[10419974] The Streptomyces peucetius dpsC gene determines the choice of starter unit in biosynthesis of the daunorubicin polyketide. (J Bacteriol. , 1999)

close this sectionSequence

selected fasta
>putative cyclase [PokC2]
MRLVDLSSPVDARGWEPEPVTHEVITPAEGARHMADEMREHFGIDFDPSVLDDGELLSID
TLRLTSHTGTHIDAPAHYGTRASYREGPPRTVDELPLDWFHRPAVVLDLTDAEPGAVGAD
RIRAELDRTGVEPAPLDIVLLHTGADRWAGTEKYFTHFTGLDGPAVHLLLDLGVKVIGTD
AFSLDAPFGDILRRYRQTGDRSVLWPAHFTGRDREFCQIERLANLDRLPPHGFTLSCFPV
KIAGAGAGWTRAVAFIDDDEG
selected fasta
>putative cyclase [PokC2]
ATGAGACTGGTCGACCTGTCGTCACCCGTCGACGCCCGGGGCTGGGAGCCCGAGCCGGTG
ACCCACGAGGTGATCACACCGGCCGAGGGCGCCCGGCACATGGCCGACGAGATGCGTGAG
CACTTCGGCATCGACTTCGACCCGAGCGTGCTCGACGACGGCGAACTGCTGTCGATCGAC
ACGCTGCGGCTCACCTCCCACACCGGTACCCACATCGACGCGCCGGCCCACTACGGGACC
CGCGCCTCCTACCGCGAGGGTCCGCCCCGTACCGTCGACGAGCTCCCGCTCGACTGGTTC
CACCGGCCCGCCGTCGTCCTCGACCTCACCGACGCCGAGCCGGGCGCCGTCGGGGCCGAC
CGCATACGAGCCGAACTGGACCGGACGGGTGTCGAGCCGGCACCCCTGGACATCGTGCTC
CTGCACACCGGGGCCGACCGGTGGGCCGGCACGGAGAAGTACTTCACCCACTTCACGGGA
CTCGACGGACCCGCCGTGCACCTCCTGCTCGACCTGGGGGTGAAGGTGATCGGCACGGAC
GCGTTCAGCCTGGACGCGCCCTTCGGCGACATCCTGCGACGGTACCGGCAGACCGGGGAC
CGCTCGGTCCTGTGGCCCGCCCACTTCACGGGGCGCGACCGCGAGTTCTGCCAGATCGAG
CGTCTCGCCAACCTGGACCGGCTGCCTCCGCACGGCTTCACCCTCTCCTGCTTCCCCGTG
AAGATCGCTGGAGCCGGAGCAGGCTGGACCCGCGCGGTCGCTTTCATCGACGACGACGAG
GGCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR007325 Putative cyclase (Family)
 [4-187]  1.6e-38 PF04199
PF04199   Cyclase
SignalP
 [1-12]  0.067 Signal
Eukaryota   
TMHMM No significant hit