close all open/close all

CDS information : Polk_00320


close this sectionLocation

Organism
StrainTü6028
Entry namePolyketomycin
Contig
Start / Stop / Direction39,977 / 41,092 / + [in whole cluster]
39,977 / 41,092 / + [in contig]
Location39977..41092 [in whole cluster]
39977..41092 [in contig]
TypeCDS
Length1,116 bp (371 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.2 modification methylation
Productputative O-methyltransferase
Product (GenBank)PokMT3
Gene
Gene (GenBank)pokMT3
EC number2.1.1.-
Keyword
Note
Note (GenBank)
  • O-methyltransferase
Reference
ACC
PmId
[19266534] Organisation of the biosynthetic gene cluster and tailoring enzymes in the biosynthesis of the tetracyclic quinone glycoside antibiotic polyketomycin. (Chembiochem. , 2009)
Related Reference
ACC
P16559
PmId
[1548230] Nucleotide sequence of the tcmII-tcmIV region of the tetracenomycin C biosynthetic gene cluster of Streptomyces glaucescens and evidence that the tcmN gene encodes a multifunctional cyclase-dehydratase-O-methyl transferase. (J Bacteriol. , 1992)
ACC
Q7X2G8
NITE
Gilvo_00100
PmId
[22800463] Roles of the Synergistic Reductive O-Methyltransferase GilM and of O-Methyltransferase GilMT in the Gilvocarcin Biosynthetic Pathway. (J Am Chem Soc. , 2012)

close this sectionSequence

selected fasta
>putative O-methyltransferase [PokMT3]
MTDDIQVHTRGAQAAPGESDAGDTGPVAAYSFVDRPDVPPRQRLMLLANGQRFSAVVYAL
AELNVADQLVKGPRTVSELADAVGADEAALYRMLRCAALLGVFQELDGRQFALTPLAEGL
RTDLPDGVRDAVLLDGSGFFWGSFGSILHSARTGRPGFDAAHGMSFWEYLQGNPEAGEVF
DDAMTTISRRLGGLYLDRVDFSRFPVVADVGGGRGYFLAEILRRNPGVRGVLFDRAQVAD
TAGELLSEREVAHRVEVVGGDFFTDPVPAGCDAYVLKTVLHDWPDEKAVEILRGVRRAIG
DSAARLLVLEQVVAPGNTWDTAKFLDVDMLVVMGGRERNLDEWRALLAAGGFALDCEPAV
GDWAVLECRPC
selected fasta
>putative O-methyltransferase [PokMT3]
ATGACCGACGACATCCAGGTGCATACGCGCGGGGCCCAGGCGGCGCCGGGCGAGAGCGAC
GCGGGCGACACCGGGCCGGTGGCGGCGTACTCCTTCGTCGACCGGCCGGACGTCCCGCCG
CGCCAGCGGCTCATGCTGCTCGCCAACGGGCAGCGCTTCTCCGCCGTCGTGTACGCGCTC
GCCGAACTCAACGTCGCCGACCAGCTGGTCAAGGGACCCCGCACGGTCTCCGAACTGGCC
GACGCGGTCGGCGCCGACGAGGCGGCGCTCTACCGCATGCTGCGCTGTGCCGCCCTGCTC
GGTGTGTTCCAGGAGCTCGACGGGCGGCAGTTCGCCCTCACCCCCCTCGCCGAGGGGCTG
CGCACCGACCTGCCCGACGGGGTGCGGGACGCCGTGCTGCTCGACGGATCCGGTTTCTTC
TGGGGCTCGTTCGGCTCGATCCTGCACTCCGCGCGGACCGGCCGGCCCGGCTTCGACGCC
GCGCACGGTATGTCGTTCTGGGAGTACCTCCAGGGCAACCCGGAGGCGGGCGAGGTCTTC
GACGACGCCATGACCACCATCAGCCGGCGGCTCGGCGGGCTCTATCTGGACCGCGTCGAC
TTCTCCCGGTTCCCCGTCGTCGCCGACGTCGGCGGAGGCCGGGGCTACTTCCTCGCCGAG
ATCCTGCGGCGCAACCCCGGCGTCCGCGGTGTGCTCTTCGACCGTGCGCAAGTAGCCGAC
ACCGCAGGTGAGTTGCTGAGCGAGCGTGAGGTCGCCCACCGCGTGGAGGTGGTCGGCGGC
GACTTCTTCACCGACCCGGTCCCGGCCGGCTGCGACGCGTACGTCCTGAAGACCGTGCTG
CACGACTGGCCGGACGAGAAGGCCGTGGAGATCCTGCGCGGCGTACGACGGGCCATCGGC
GACTCCGCGGCGCGCCTGCTCGTCCTCGAACAGGTCGTGGCACCCGGCAACACCTGGGAC
ACCGCCAAGTTCCTGGACGTCGACATGCTCGTGGTGATGGGCGGGCGCGAGCGCAACCTC
GACGAATGGCGCGCGCTGCTCGCCGCCGGCGGCTTCGCCCTGGACTGCGAACCGGCCGTC
GGCGACTGGGCGGTACTGGAATGCAGGCCGTGCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001077 O-methyltransferase, family 2 (Domain)
 [109-347]  1.09999999999999e-62 PF00891
PF00891   Methyltransf_2
IPR011991 Winged helix-turn-helix transcription repressor DNA-binding (Domain)
 [41-118]  1e-12 G3DSA:1.10.10.10
G3DSA:1.10.10.10   Wing_hlx_DNA_bd
IPR016461 O-methyltransferase, caffeic acid-type (Family)
 [24-370]  1.89999859865864e-13 PIRSF005739
PIRSF005739   O-mtase
SignalP
 [1-14]  0.099 Signal
Bacteria, Gram-negative   
TMHMM No significant hit