close all open/close all

CDS information : Polk_00340


close this sectionLocation

Organism
StrainTü6028
Entry namePolyketomycin
Contig
Start / Stop / Direction42,076 / 41,747 / - [in whole cluster]
42,076 / 41,747 / - [in contig]
Locationcomplement(41747..42076) [in whole cluster]
complement(41747..42076) [in contig]
TypeCDS
Length330 bp (109 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.3 modification reduction
Productputative oxidoreductase
Product (GenBank)PokO3
Gene
Gene (GenBank)pokO3
EC number
Keyword
  • quinone formation
Note
Note (GenBank)
  • putative monooxygenase
Reference
ACC
PmId
[19266534] Organisation of the biosynthetic gene cluster and tailoring enzymes in the biosynthesis of the tetracyclic quinone glycoside antibiotic polyketomycin. (Chembiochem. , 2009)
Related Reference
ACC
Q8VWB4
PmId
[12399480] Expression, purification, and characterization of AknX anthrone oxygenase, which is involved in aklavinone biosynthesis in Streptomyces galilaeus. (J Bacteriol. , 2002)
ACC
O54259
NITE
Nogl_00350
PmId
[19255477] Expression, purification and crystallization of the cofactor-independent monooxygenase SnoaB from the nogalamycin biosynthetic pathway. (Acta Crystallogr Sect F Struct Biol Cryst Commun. , 2009)
[20052967] Crystal structure of the cofactor-independent monooxygenase SnoaB from Streptomyces nogalater: implications for the reaction mechanism. (Biochemistry. , 2010)

close this sectionSequence

selected fasta
>putative oxidoreductase [PokO3]
MTPDHHRPRPRSTTMVTLINKFTVTGEVDAFRRAIAEVSAYMQAQPGFISHEVYRSISKP
NIFVETAHWDDPDSHKRAVQSEEFRNRVRGLAGLATPDADLYAPVGEDR
selected fasta
>putative oxidoreductase [PokO3]
ATGACACCGGACCACCACCGACCCCGACCAAGGAGTACGACCATGGTGACCCTGATCAAC
AAGTTCACGGTGACGGGCGAAGTAGACGCGTTCCGGCGCGCCATCGCCGAGGTCAGCGCC
TACATGCAGGCGCAGCCGGGCTTCATCAGCCACGAGGTCTACCGCTCGATCAGCAAGCCG
AACATCTTCGTGGAGACCGCCCACTGGGACGACCCCGACTCGCACAAAAGGGCGGTGCAG
AGCGAGGAGTTCCGCAACCGTGTCCGCGGCCTGGCCGGTCTCGCCACGCCCGACGCCGAC
CTGTACGCGCCGGTCGGCGAGGATCGCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR007138 Antibiotic biosynthesis monooxygenase (Domain)
 [15-87]  7.1e-16 PF03992
PF03992   ABM
IPR011008 Dimeric alpha-beta barrel (Domain)
 [15-101]  1.60000240695997e-17 SSF54909
SSF54909   Dimer_A_B_barrel
SignalP No significant hit
TMHMM No significant hit