close all open/close all

CDS information : Polk_00350


close this sectionLocation

Organism
StrainTü6028
Entry namePolyketomycin
Contig
Start / Stop / Direction43,560 / 42,073 / - [in whole cluster]
43,560 / 42,073 / - [in contig]
Locationcomplement(42073..43560) [in whole cluster]
complement(42073..43560) [in contig]
TypeCDS
Length1,488 bp (495 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.1 general function
Productputative ligase
Product (GenBank)PokL
Gene
Gene (GenBank)pokL
EC number
Keyword
Note
Note (GenBank)
  • putative acyl-CoA ligase
Reference
ACC
PmId
[19266534] Organisation of the biosynthetic gene cluster and tailoring enzymes in the biosynthesis of the tetracyclic quinone glycoside antibiotic polyketomycin. (Chembiochem. , 2009)
Related Reference
ACC
P41636
PmId
[9008388] Molecular cloning of 4-coumarate:coenzyme A ligase in loblolly pine and the roles of this enzyme in the biosynthesis of lignin in compression wood. (Plant Physiol. , 1997)

close this sectionSequence

selected fasta
>putative ligase [PokL]
MREPVERLDELPRLAAEAHPDRVALRTDRSDALTFGELEQRVSGCAARIRALVGGPGTTV
AITSVLHPDFAVAYYGTLRAGHVVVPVNPFLRAKGLEALVAASGARLVLTTEEIAAELGD
TVPSLDIGDRTLWDTGPLREAPAVRPDDVASIHFTSGTTGAPKGVRQTHHNLAVNAAQTV
HAHGLDDSSVTVNHLPTFHPMHLNSALFAAAEQVLATDPDLAASLRTANEARATRYYSLP
MRLSRLAARPDLSELRLDTVEAVFSGGSALAVPAARRLGDHFGIPVLQGYGLAETAPMTH
CGSRTRPKEGSCGPPVPRTECRIVDLATGKALGPGERGEIQVRGPQLMKGYLGEPDGGAL
DAEGWFATGDVGEVDEDDCLFVVDRLKDVFKCDNWLVSPQEIEQVLLAHPAVADCAVVDH
PDEFSGAVAVALVVTRRPEEPEALDGIAADVNSGLPYYQHIRHIRAVPDIARSGGGKVRR
QDLRRLFTELFATRG
selected fasta
>putative ligase [PokL]
GTGCGTGAGCCCGTCGAGCGCCTGGACGAGCTGCCGCGGCTCGCCGCCGAGGCCCACCCC
GACCGTGTCGCCCTGCGCACGGACCGCAGCGACGCGCTGACCTTCGGGGAGCTGGAGCAG
CGGGTGAGCGGCTGCGCGGCACGCATCCGCGCTCTGGTGGGCGGGCCCGGCACGACCGTC
GCGATCACCTCGGTCCTCCATCCCGACTTCGCCGTGGCGTACTACGGCACGCTGCGCGCG
GGCCATGTCGTCGTGCCGGTCAATCCCTTCCTCCGGGCGAAGGGTCTGGAGGCCCTCGTC
GCCGCGAGCGGCGCACGGCTGGTGCTCACGACGGAGGAGATCGCCGCCGAGCTCGGCGAC
ACGGTGCCGTCGCTGGACATCGGCGACCGGACGCTGTGGGACACCGGACCGCTGCGGGAG
GCGCCCGCCGTGCGCCCCGACGACGTCGCGTCCATCCACTTCACCAGCGGCACGACCGGC
GCCCCGAAGGGCGTGCGGCAGACCCATCACAACCTGGCGGTCAACGCGGCGCAGACCGTG
CACGCGCACGGTCTGGACGACAGCTCGGTGACCGTCAACCATCTGCCCACGTTCCACCCG
ATGCACCTGAACTCGGCGCTGTTCGCGGCCGCCGAGCAGGTGCTGGCCACCGATCCGGAC
CTGGCGGCGTCGCTGCGGACGGCGAACGAGGCGCGGGCCACCCGGTACTACAGCCTGCCG
ATGCGGCTCAGCCGTCTCGCGGCGCGACCGGACCTGTCGGAGCTGCGGCTCGACACCGTG
GAGGCCGTGTTCTCCGGCGGCTCCGCACTGGCGGTCCCGGCGGCGCGCAGGCTCGGCGAC
CACTTCGGGATCCCGGTCCTCCAGGGGTACGGGCTCGCCGAGACGGCGCCGATGACCCAC
TGCGGCAGCCGCACCCGGCCCAAGGAGGGTTCGTGCGGACCCCCGGTCCCCCGCACCGAG
TGCCGGATCGTCGACCTCGCCACCGGCAAGGCACTCGGCCCCGGTGAGCGCGGCGAGATC
CAGGTGCGCGGCCCGCAGTTGATGAAGGGCTACCTGGGCGAGCCCGACGGCGGCGCCCTG
GACGCCGAGGGCTGGTTCGCCACCGGGGACGTCGGCGAGGTCGACGAGGACGACTGCCTC
TTCGTCGTCGACCGGCTCAAGGACGTCTTCAAGTGCGACAACTGGCTGGTCTCCCCGCAG
GAGATCGAGCAGGTGCTGCTCGCGCACCCCGCCGTGGCGGACTGCGCGGTCGTCGACCAC
CCGGACGAGTTCAGCGGCGCCGTGGCGGTCGCCCTCGTGGTGACCCGTCGTCCCGAGGAG
CCCGAAGCACTGGACGGCATCGCCGCGGACGTCAACTCCGGCCTGCCGTACTACCAGCAC
ATCCGGCACATCCGGGCGGTCCCCGACATCGCCCGGTCCGGCGGCGGCAAGGTCCGCCGC
CAGGACCTGCGCCGGCTCTTCACGGAACTGTTCGCCACGCGCGGATGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000873 AMP-dependent synthetase/ligase (Domain)
 [34-417]  1.79999999999997e-86 PF00501
PF00501   AMP-binding
IPR020845 AMP-binding, conserved site (Conserved_site)
 [152-163]  PS00455
PS00455   AMP_BINDING
SignalP No significant hit
TMHMM No significant hit