close all open/close all

CDS information : Polk_00360


close this sectionLocation

Organism
StrainTü6028
Entry namePolyketomycin
Contig
Start / Stop / Direction44,497 / 43,553 / - [in whole cluster]
44,497 / 43,553 / - [in contig]
Locationcomplement(43553..44497) [in whole cluster]
complement(43553..44497) [in contig]
TypeCDS
Length945 bp (314 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.4 other modification
Productputative cyclase/dehydratase
Product (GenBank)PokC3
Gene
Gene (GenBank)pokC3
EC number
Keyword
  • 1st ring
  • unreduced polyketide
Note
Note (GenBank)
  • putative aromatase
Reference
ACC
PmId
[19266534] Organisation of the biosynthetic gene cluster and tailoring enzymes in the biosynthesis of the tetracyclic quinone glycoside antibiotic polyketomycin. (Chembiochem. , 2009)
Related Reference
ACC
Q2PA00
NITE
Stref_00150
PmId
[16751529] Isolation, characterization, and heterologous expression of the biosynthesis gene cluster for the antitumor anthracycline steffimycin. (Appl Environ Microbiol. , 2006)
ACC
Q54221
NITE
Griseu_00050
PmId
[8169211] Cloning, sequencing, and analysis of the griseusin polyketide synthase gene cluster from Streptomyces griseus. (J Bacteriol. , 1994)
[9195917] Domain analysis of the molecular recognition features of aromatic polyketide synthase subunits. (J Biol Chem. , 1997)
[10467128] Heterologous expression, purification, reconstitution and kinetic analysis of an extended type II polyketide synthase. (Chem Biol. , 1999)

close this sectionSequence

selected fasta
>putative cyclase/dehydratase [PokC3]
MEGTPVVNTQAPVGESVVVDAPAKVVLDLITDPDPLHYLSPSVVHADRTARGGAQDSVTI
WTITDDERVWSRTQDRTLDADGLRVSFEDTPESSLAGVRGAWVLRAVSEDKTEIELRQDT
SALTSPEDLARAESARSDLLSTVAYAAANRQELSDLVVDFRDPLFAAGSAEDAYRILYEA
DRWPERLAHVSRIDMTEDVPGIQFFDMDTTTSDGAPHTTRSVRICFPHSKIVYKQIGLPA
LLDAHTGHWLFTPTREGIVVESRHVAVIKPSALPILGEGTTVEDARRYLRRVLSTNSMTN
LRLSKEFAEEQARA
selected fasta
>putative cyclase/dehydratase [PokC3]
GTGGAAGGAACACCAGTGGTCAACACCCAAGCCCCCGTGGGCGAATCGGTCGTCGTCGAC
GCGCCGGCGAAGGTCGTCCTCGACCTGATCACCGATCCCGATCCGCTGCACTACCTCTCC
CCCTCCGTCGTCCACGCGGACCGGACCGCCCGGGGCGGGGCGCAGGACTCCGTGACGATC
TGGACCATCACCGACGACGAGCGGGTGTGGTCCCGCACCCAGGACCGCACGCTGGACGCC
GACGGCCTGCGGGTCTCGTTCGAGGACACGCCCGAGTCCTCGCTCGCCGGTGTGCGCGGC
GCGTGGGTGCTGCGCGCGGTCTCGGAGGACAAGACCGAGATCGAGCTGCGGCAGGACACG
AGCGCGCTGACCTCCCCCGAGGACCTCGCTCGTGCGGAGTCGGCACGCTCCGACCTGCTG
TCGACGGTGGCGTACGCCGCCGCGAACCGGCAGGAACTGTCCGACCTGGTCGTCGACTTC
CGGGACCCGCTGTTCGCCGCGGGGTCCGCCGAGGACGCGTACCGGATCCTGTACGAGGCC
GATCGCTGGCCCGAGCGGCTCGCCCACGTCTCCCGGATCGACATGACCGAGGACGTGCCC
GGCATCCAGTTCTTCGACATGGACACCACGACGTCCGACGGCGCCCCGCACACGACCCGT
TCGGTGCGGATCTGCTTCCCGCACTCCAAGATCGTCTACAAGCAGATCGGGCTGCCGGCG
CTGCTGGACGCGCACACCGGGCACTGGCTGTTCACCCCGACCCGGGAGGGCATCGTCGTC
GAGTCGCGGCACGTCGCCGTCATCAAGCCGTCGGCGCTGCCGATCCTCGGCGAGGGCACC
ACGGTCGAGGACGCACGCCGCTATCTGCGCCGGGTGCTGAGCACCAACTCCATGACCAAC
CTGCGGCTGTCCAAGGAGTTCGCGGAGGAGCAGGCGCGTGCGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR019587 Polyketide cyclase/dehydrase (Family)
 [14-135]  1.2e-08 PF10604
PF10604   Polyketide_cyc2
SignalP
 [1-23]  0.125 Signal
Bacteria, Gram-positive   
 [1-46]  0.054 Signal
Bacteria, Gram-negative   
TMHMM No significant hit