close all open/close all

CDS information : Polk_00370


close this sectionLocation

Organism
StrainTü6028
Entry namePolyketomycin
Contig
Start / Stop / Direction45,302 / 44,547 / - [in whole cluster]
45,302 / 44,547 / - [in contig]
Locationcomplement(44547..45302) [in whole cluster]
complement(44547..45302) [in contig]
TypeCDS
Length756 bp (251 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.1 general function
Productputative oxidoreductase
Product (GenBank)PokT2
Gene
Gene (GenBank)pokT2
EC number
Keyword
Note
Note (GenBank)
  • putative ketoreductase
Reference
ACC
PmId
[19266534] Organisation of the biosynthetic gene cluster and tailoring enzymes in the biosynthesis of the tetracyclic quinone glycoside antibiotic polyketomycin. (Chembiochem. , 2009)
Related Reference
ACC
P50205
PmId
[7582015] Poly-beta-hydroxybutyrate (PHB) biosynthetic genes in Rhizobium meliloti 41. (Microbiology. , 1995)

close this sectionSequence

selected fasta
>putative oxidoreductase [PokT2]
MDLGLTDRVVLVTGGTRGIGEATVRAFAAEGARVALTYAGAKDTADRLVRELGGPDRALA
VHYDLARPGSVEDLVPTVERHFGTVDVLVANAVRRPAGRPRPGFERLDPADWAAFLDDNL
TGTIRTVQTALGAMRAQGRGRIALISSHLAAKGQAGQEVYTAAKSALHGFALSLARDAGP
DGVLVNVISPGLTTTEGALSHLPAAVLEKAAAALPTGRLGSPEEVARTVVFYCSAANENI
TGELVSLVGRG
selected fasta
>putative oxidoreductase [PokT2]
ATGGATCTCGGACTGACCGACCGGGTCGTCCTCGTCACGGGCGGCACCCGGGGCATCGGG
GAGGCGACCGTGCGCGCCTTCGCCGCCGAGGGCGCCCGCGTCGCGCTGACCTATGCCGGC
GCGAAGGACACAGCGGACCGCCTGGTGCGCGAACTCGGCGGACCGGACAGGGCTCTGGCG
GTCCACTACGACCTGGCCCGGCCCGGCTCGGTCGAGGACCTCGTACCGACGGTCGAGCGG
CACTTCGGCACGGTCGACGTCCTCGTCGCGAACGCCGTGCGCCGGCCCGCGGGACGCCCG
CGGCCGGGCTTCGAACGCCTGGACCCGGCGGACTGGGCCGCGTTCCTGGACGACAACCTG
ACCGGGACGATCCGCACGGTGCAGACCGCGCTCGGCGCCATGCGTGCCCAGGGCCGCGGC
CGCATCGCCCTGATCTCCTCCCACCTGGCCGCCAAGGGCCAGGCGGGCCAGGAGGTCTAC
ACGGCGGCGAAGTCGGCGCTGCACGGCTTCGCTCTCAGTCTGGCCCGCGACGCCGGCCCC
GACGGGGTCCTGGTCAATGTGATCAGTCCCGGGCTCACCACGACCGAGGGGGCCTTGAGC
CACCTCCCCGCGGCCGTCCTGGAGAAGGCCGCGGCCGCACTGCCGACCGGGCGCCTCGGC
AGCCCGGAGGAGGTCGCCAGGACCGTCGTCTTCTACTGCTCGGCGGCCAACGAGAACATC
ACCGGCGAGCTGGTCTCCCTGGTCGGGCGCGGGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR002198 Short-chain dehydrogenase/reductase SDR (Family)
 [83-94]  2.90000036269908e-05 PR00080 [140-148]  2.90000036269908e-05 PR00080 [160-179]  2.90000036269908e-05 PR00080
PR00080   SDRFAMILY
 [9-177]  1.1e-27 PF00106
PF00106   adh_short
IPR002347 Glucose/ribitol dehydrogenase (Family)
 [9-26]  1.20000117458134e-32 PR00081 [83-94]  1.20000117458134e-32 PR00081 [134-150]  1.20000117458134e-32 PR00081 [160-179]  1.20000117458134e-32 PR00081 [181-198]  1.20000117458134e-32 PR00081 [215-235]  1.20000117458134e-32 PR00081
PR00081   GDHRDH
IPR016040 NAD(P)-binding domain (Domain)
 [4-247]  3.19999999999996e-67 G3DSA:3.40.50.720
G3DSA:3.40.50.720   NAD(P)-bd
IPR020904 Short-chain dehydrogenase/reductase, conserved site (Conserved_site)
 [147-175]  PS00061
PS00061   ADH_SHORT
SignalP
 [1-28]  0.103 Signal
Bacteria, Gram-negative   
 [1-28]  0.167 Signal
Bacteria, Gram-positive   
TMHMM No significant hit