close all open/close all

CDS information : Polk_00380


close this sectionLocation

Organism
StrainTü6028
Entry namePolyketomycin
Contig
Start / Stop / Direction46,937 / 45,312 / - [in whole cluster]
46,937 / 45,312 / - [in contig]
Locationcomplement(45312..46937) [in whole cluster]
complement(45312..46937) [in contig]
TypeCDS
Length1,626 bp (541 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.3 modification reduction
Productputative oxidoreductase
Product (GenBank)PokO2
Gene
Gene (GenBank)pokO2
EC number
Keyword
Note
Note (GenBank)
  • monooxygenase
Reference
ACC
PmId
[19266534] Organisation of the biosynthetic gene cluster and tailoring enzymes in the biosynthesis of the tetracyclic quinone glycoside antibiotic polyketomycin. (Chembiochem. , 2009)
Related Reference
ACC
Q194R1
NITE
Mith_00090
PmId
[10102355] Analysis of two chromosomal regions adjacent to genes for a type II polyketide synthase involved in the biosynthesis of the antitumor polyketide mithramycin in Streptomyces argillaceus. (Mol Gen Genet. , 1999)
[16856198] Premithramycinone G, an early shunt product of the mithramycin biosynthetic pathway accumulated upon inactivation of oxygenase MtmOII. (Angew Chem Int Ed Engl. , 2006)
ACC
Q3S8Q4
NITE
Oxtet_00120
PmId
[18422316] Identifying the minimal enzymes required for anhydrotetracycline biosynthesis. (J Am Chem Soc. , 2008)
ACC
Q58PK7
PmId
[16148009] Ablation of the otcC gene encoding a post-polyketide hydroxylase from the oxytetracyline biosynthetic pathway in Streptomyces rimosus results in novel polyketides with altered chain length. (J Biol Chem. , 2005)

close this sectionSequence

selected fasta
>putative oxidoreductase [PokO2]
MAVTKGPRTPQVLVAGAGPVGLALAFELARRGIRCVSFDAKDAPANTSRAVATHPRTWRR
TTNGPGRRDAQAGREIRAFTLFQDGRRLARLDADYSTMPTRFPFTLAIEQTATEEVFRDA
LADLGVVPEWGTKLERIARDDDGVTVGLTHADGRRETVRTPWLVGCDGGHSTVRRSLELP
LIGEANQTWLLADAPLTSELPPNSIYWVRAEGGTLMAVPLADDRWRLLDTAETDYDGDPG
RLAARFERKLSQGIGHRVRIGTPTWVSVFTAQQRMVPAMRVGRCLVAGDAAHVHSPASGQ
GMNTGIQEAVNLAWKLAMVIDGHARAELLDSYTSERVPVGEALLESTKKATQMIELRSRF
TDLALPVIFGVVSRVAPIRRRMQREMLGGMSGLLLSYADRSLTVADTGGGSGPRPGTRLT
EVTDSDLTGTGWPALLTALRRPGWLLLTAPAPHEPAVADAVGRARQEHGGWLSVLSVTEA
KSATDPEMIPDSDGRVSERLGLSPGGWLLVRPDGYLLARGPALSWPALSTALGRLPLARP
R
selected fasta
>putative oxidoreductase [PokO2]
ATGGCAGTGACGAAAGGACCTCGCACTCCCCAGGTACTCGTGGCGGGGGCCGGCCCGGTG
GGGCTCGCCCTGGCGTTCGAACTCGCCCGCCGCGGAATCCGTTGCGTCTCATTCGACGCG
AAGGACGCGCCCGCGAACACCAGCCGCGCCGTCGCCACGCATCCGCGCACCTGGAGGCGT
ACAACAAATGGGCCTGGTCGAAGAGATGCTCAAGCGGGCCGGGAGATCCGGGCCTTCACC
CTCTTCCAGGACGGTCGCCGGCTCGCCCGCCTGGACGCGGACTACTCGACGATGCCGACC
CGGTTCCCCTTCACGCTCGCCATCGAGCAGACGGCGACCGAGGAGGTGTTCCGCGACGCG
CTCGCGGACCTCGGAGTGGTCCCCGAATGGGGTACGAAGCTGGAGCGGATCGCGCGCGAC
GACGACGGCGTGACGGTGGGGCTGACCCATGCCGACGGCCGGCGGGAGACCGTGCGCACC
CCGTGGCTGGTCGGCTGCGACGGCGGGCACAGCACCGTACGCCGTTCCCTGGAACTCCCG
CTGATCGGCGAGGCCAACCAGACCTGGCTGCTGGCCGACGCACCCCTGACCAGCGAGCTG
CCGCCCAACAGCATCTACTGGGTGCGCGCCGAGGGCGGCACCCTCATGGCGGTGCCCCTC
GCCGACGACCGGTGGCGGCTGCTGGACACCGCCGAGACCGACTACGACGGCGACCCCGGC
CGTCTCGCGGCGCGTTTCGAGCGCAAGCTCAGCCAGGGCATCGGCCACCGGGTACGGATC
GGCACCCCGACCTGGGTGTCCGTCTTCACGGCGCAGCAGCGCATGGTCCCGGCCATGCGC
GTGGGCCGCTGCCTGGTGGCGGGCGACGCGGCCCATGTGCACAGCCCGGCGTCCGGGCAG
GGCATGAACACCGGCATCCAGGAGGCCGTCAATCTGGCCTGGAAGCTCGCGATGGTCATC
GACGGACATGCCCGTGCGGAGCTGCTGGACAGCTACACCAGCGAGCGCGTGCCGGTGGGC
GAGGCCCTCCTGGAGTCCACCAAGAAGGCCACGCAGATGATCGAGCTGCGCAGCCGGTTC
ACGGACCTGGCGCTGCCCGTGATCTTCGGGGTGGTGAGCCGGGTCGCCCCCATCCGCAGG
CGGATGCAGCGGGAGATGCTCGGCGGGATGTCGGGGCTGCTGCTCTCGTACGCGGACCGT
TCGCTGACCGTCGCGGACACCGGCGGCGGCAGCGGCCCCCGCCCGGGGACCCGGCTCACC
GAGGTCACCGACTCGGACCTCACGGGCACCGGCTGGCCCGCACTGCTCACGGCACTGCGC
CGGCCCGGCTGGCTGCTGCTGACCGCCCCGGCGCCGCACGAGCCCGCCGTCGCCGACGCG
GTCGGCCGGGCACGGCAGGAGCACGGCGGCTGGCTGTCGGTGCTGAGCGTCACGGAGGCG
AAGTCGGCCACCGACCCGGAGATGATCCCCGACAGCGACGGACGGGTCTCGGAACGGCTC
GGCCTGTCCCCCGGCGGATGGCTCCTGGTCCGCCCCGACGGCTATCTGCTCGCCCGTGGG
CCCGCACTGTCCTGGCCGGCCCTGTCCACCGCGCTCGGGCGGCTGCCGCTCGCCCGTCCC
CGCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR002938 Monooxygenase, FAD-binding (Domain)
 [11-345]  1.6e-69 PF01494
PF01494   FAD_binding_3
IPR003042 Aromatic-ring hydroxylase-like (Domain)
 [11-33]  2.5e-43 PR00420 [159-174]  2.5e-43 PR00420 [281-296]  2.5e-43 PR00420 [296-312]  2.5e-43 PR00420 [314-332]  2.5e-43 PR00420 [332-348]  2.5e-43 PR00420
PR00420   RNGMNOXGNASE
SignalP
 [1-25]  0.911 Signal
Eukaryota   
 [1-25]  0.461 Signal
Bacteria, Gram-negative   
TMHMM No significant hit