close all open/close all

CDS information : Polk_00400


close this sectionLocation

Organism
StrainTü6028
Entry namePolyketomycin
Contig
Start / Stop / Direction48,823 / 49,437 / + [in whole cluster]
48,823 / 49,437 / + [in contig]
Location48823..49437 [in whole cluster]
48823..49437 [in contig]
TypeCDS
Length615 bp (204 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.3 modification addition of sugar moiety
Productputative NDP-hexose epimerase
Product (GenBank)PokS7
Gene
Gene (GenBank)pokS7
EC number5.1.3.-
Keyword
  • alpha-L-axenose
Note
Note (GenBank)
  • putative NDP-hexose 3,5-epimerase
Reference
ACC
PmId
[19266534] Organisation of the biosynthetic gene cluster and tailoring enzymes in the biosynthesis of the tetracyclic quinone glycoside antibiotic polyketomycin. (Chembiochem. , 2009)
Related Reference
ACC
A4F7N1
PmId
[15610855] Engineering biosynthetic pathways for deoxysugars: branched-chain sugar pathways and derivatives from the antitumor tetracenomycin. (Chem Biol. , 2004)

close this sectionSequence

selected fasta
>putative NDP-hexose epimerase [PokS7]
MTGMRTRRLAVAGSFEFTPEIHTDARGLFVSPLQEEAFVAAVGEPFVTAQTNHSRSARGV
LRGLHFTTTPPGQAKYVYCAQGRALDAVVDIRLGSPTFGKWDIVEMDAVSYRAVYIPDGA
GHAFLALDDDTVMSYLVSSAYRTELEQAVDPLDPALGLPWPYDMEFVMSERDTTAVSLAE
AEARGMLPRYEDCRQWPAEAEPGR
selected fasta
>putative NDP-hexose epimerase [PokS7]
GTGACCGGGATGCGTACGCGCAGGCTCGCGGTGGCAGGCAGCTTCGAGTTCACCCCCGAG
ATCCACACGGACGCGCGGGGGCTGTTCGTGTCGCCCCTTCAGGAGGAGGCGTTCGTCGCG
GCGGTCGGCGAGCCGTTCGTGACCGCGCAGACGAACCACAGCCGCTCCGCCCGGGGCGTG
CTGCGCGGGCTGCACTTCACGACCACACCTCCCGGCCAGGCCAAGTACGTGTACTGCGCG
CAGGGCCGGGCCCTCGACGCGGTCGTCGACATCCGGCTCGGCTCACCGACCTTCGGCAAG
TGGGACATCGTGGAGATGGACGCCGTCTCCTACCGTGCCGTGTACATCCCCGACGGCGCC
GGGCACGCCTTCCTCGCGCTCGACGACGACACCGTGATGTCGTACCTCGTCTCCAGCGCC
TACCGGACCGAACTGGAGCAGGCCGTCGACCCGCTGGACCCGGCCCTCGGCCTGCCGTGG
CCGTACGACATGGAGTTCGTCATGTCGGAGCGCGACACGACCGCCGTCTCGCTCGCCGAG
GCGGAGGCGCGGGGGATGCTGCCCCGCTACGAGGACTGCCGGCAGTGGCCCGCGGAAGCG
GAACCCGGCCGGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000888 dTDP-4-dehydrorhamnose 3,5-epimerase-related (Family)
 [7-180]  4.6e-55 PF00908
PF00908   dTDP_sugar_isom
 [13-185]  PD001462
PD001462   dTDP_sugar_isom
IPR011051 RmlC-like cupin domain (Domain)
 [4-185]  1.19999063421924e-67 SSF51182
SSF51182   RmlC_like_cupin
IPR014710 RmlC-like jelly roll fold (Domain)
 [4-193]  5.79999999999997e-61 G3DSA:2.60.120.10
G3DSA:2.60.120.10   RmlC-like_jellyroll
SignalP
 [1-12]  0.554 Signal
Bacteria, Gram-negative   
TMHMM No significant hit