close all open/close all

CDS information : Polk_00410


close this sectionLocation

Organism
StrainTü6028
Entry namePolyketomycin
Contig
Start / Stop / Direction49,434 / 50,393 / + [in whole cluster]
49,434 / 50,393 / + [in contig]
Location49434..50393 [in whole cluster]
49434..50393 [in contig]
TypeCDS
Length960 bp (319 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.3 modification addition of sugar moiety
Productputative NDP-hexose C-4 ketoreductase
Product (GenBank)PokS9
Gene
Gene (GenBank)pokS9
EC number
Keyword
Note
Note (GenBank)
  • putative NDP-hexose 4-ketoreductase
Reference
ACC
PmId
[19266534] Organisation of the biosynthetic gene cluster and tailoring enzymes in the biosynthesis of the tetracyclic quinone glycoside antibiotic polyketomycin. (Chembiochem. , 2009)
Related Reference
ACC
O33708
NITE
Adria_00200
PmId
[9209071] Cloning and characterization of the Streptomyces peucetius dnmZUV genes encoding three enzymes required for biosynthesis of the daunorubicin precursor thymidine diphospho-L-daunosamine. (J Bacteriol. , 1997)
[10631513] A two-plasmid system for the glycosylation of polyketide antibiotics: bioconversion of epsilon-rhodomycinone to rhodomycin D. (Chem Biol. , 1999)
[9447597] Production of the antitumor drug epirubicin (4'-epidoxorubicin) and its precursor by a genetically engineered strain of Streptomyces peucetius. (Nat Biotechnol. , 1998)

close this sectionSequence

selected fasta
>putative NDP-hexose C-4 ketoreductase [PokS9]
MSEAPARGPAASGANGRVAVIGATGCVGRQIAEAFAARGTEVVAVARRPAPHVAAHRFVA
LDVAAAPAERLAELLAAQRVDAVVNATLGWGEELHAINVHLVERLVDALKKTPEPPRLVQ
LGTIHEYGPVPRGTSIDERVRPDPRQPYPRSKLVAARLVLDAARAGELDGVVLRLTNTIG
PHPAAESFFGSLAARLRDEPGTVDLTLAEAHRDYVDSRDAADAVVLAAESPAAHGVFNIG
TGRARDIRTLVAALVRASGRPPDSVRGHPGAVHSRGADWIQVDSTRARRLLGWSPRHDLD
ASMRAMWETVRAERVPGAR
selected fasta
>putative NDP-hexose C-4 ketoreductase [PokS9]
GTGAGCGAGGCGCCCGCGAGAGGGCCGGCGGCATCCGGCGCGAACGGACGGGTCGCGGTC
ATCGGCGCGACCGGGTGCGTCGGCAGGCAGATCGCCGAGGCCTTCGCCGCCCGCGGCACC
GAAGTGGTCGCCGTCGCCCGCCGGCCCGCACCGCACGTGGCCGCCCATCGGTTCGTCGCG
CTGGACGTCGCCGCCGCACCCGCCGAACGGCTCGCCGAGCTCCTGGCCGCGCAGCGGGTG
GACGCGGTGGTGAACGCGACGCTCGGCTGGGGCGAGGAACTGCACGCCATCAACGTCCAC
TTGGTGGAGCGACTGGTGGACGCACTGAAGAAGACGCCCGAGCCACCGCGCCTGGTGCAG
CTCGGCACCATCCACGAGTACGGGCCCGTCCCCCGGGGCACCTCCATCGACGAGCGGGTC
CGGCCGGACCCGAGACAGCCCTATCCCCGGTCCAAGTTGGTGGCGGCCCGCCTGGTGCTC
GACGCCGCGCGCGCCGGGGAACTCGACGGTGTGGTGCTGCGCCTCACCAACACCATCGGG
CCGCATCCCGCCGCCGAGAGCTTCTTCGGCTCCCTGGCCGCGCGGCTGCGCGACGAGCCG
GGGACGGTCGACCTGACGCTGGCCGAGGCGCACCGCGACTACGTCGACTCGCGCGACGCG
GCGGACGCGGTGGTGCTGGCCGCCGAAAGTCCCGCGGCCCACGGGGTGTTCAACATCGGT
ACCGGCCGCGCTCGCGACATCCGGACCCTGGTCGCCGCGCTGGTCCGCGCCTCGGGGCGC
CCGCCGGACTCGGTGCGCGGGCACCCGGGAGCCGTGCACAGCCGTGGCGCGGACTGGATC
CAGGTCGACAGCACACGGGCACGGCGGCTGCTCGGCTGGAGCCCGCGCCACGACCTGGAC
GCGTCGATGCGGGCGATGTGGGAGACGGTGCGCGCCGAACGGGTCCCAGGGGCCCGGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001509 NAD-dependent epimerase/dehydratase (Domain)
 [19-240]  3.99999999999998e-37 PF01370
PF01370   Epimerase
IPR016040 NAD(P)-binding domain (Domain)
 [17-216]  6.1e-29 G3DSA:3.40.50.720
G3DSA:3.40.50.720   NAD(P)-bd
SignalP
 [1-36]  0.264 Signal
Bacteria, Gram-positive   
TMHMM No significant hit