close all open/close all

CDS information : Polk_00420


close this sectionLocation

Organism
StrainTü6028
Entry namePolyketomycin
Contig
Start / Stop / Direction50,634 / 51,608 / + [in whole cluster]
50,634 / 51,608 / + [in contig]
Location50634..51608 [in whole cluster]
50634..51608 [in contig]
TypeCDS
Length975 bp (324 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.1 general function
Productputative acyl-CoA dehydrogenase
Product (GenBank)PokU3
Gene
Gene (GenBank)pokU3
EC number1.3.99.-
Keyword
Note
Note (GenBank)
  • acyl-CoA dehydrogenase
Reference
ACC
PmId
[19266534] Organisation of the biosynthetic gene cluster and tailoring enzymes in the biosynthesis of the tetracyclic quinone glycoside antibiotic polyketomycin. (Chembiochem. , 2009)
Family/Domain
FD
IPR013786, IPR006091, IPR009075

close this sectionSequence

selected fasta
>putative acyl-CoA dehydrogenase [PokU3]
MHLEYTPDQQRLRTELRDYFAQLVPDNAYARYADPASQKRFYRETVRRLGADGWLGVGWP
KEYGGRGLTPMEQFIFFDEAAQAGVPLPLMALNTVGPTIMQFGTEEQKSHFLPRILSGEI
DFAIGYSEPDAGTDLAALKTKAVRDGDGDYVVNGQKIWTTNGDTADWVWLAVRTDPDAPP
HKGITMLLVPTSDPGYSCTLINTLASHDTTASYYENIRVPVTRRVGEENKGWRLITNQLN
HERVTLAAHGTMAIRALHDVQRWAMETKLTDGRRVADLPWVRRRLAQTHTRLDAMKLLNW
KMVNAVQEGTLTPQDASAVVVSML
selected fasta
>putative acyl-CoA dehydrogenase [PokU3]
GTGCATCTCGAATACACGCCGGATCAGCAGCGTCTGCGCACCGAACTGCGCGACTACTTC
GCCCAGTTGGTACCCGACAACGCCTACGCCCGGTACGCCGACCCCGCCTCGCAGAAGCGG
TTCTACCGCGAGACCGTCCGGCGCCTGGGCGCGGACGGCTGGCTCGGGGTCGGATGGCCG
AAGGAGTACGGCGGGCGCGGGCTGACCCCCATGGAACAGTTCATCTTCTTCGACGAGGCG
GCCCAGGCGGGCGTGCCCCTGCCCCTGATGGCCCTGAACACCGTCGGCCCGACGATCATG
CAGTTCGGGACGGAGGAACAGAAGTCCCACTTCCTGCCCAGGATCCTCTCCGGCGAGATC
GACTTCGCGATCGGCTACAGCGAGCCCGACGCGGGCACCGACCTCGCCGCGCTGAAGACC
AAGGCGGTCCGCGACGGCGACGGCGACTACGTCGTGAACGGGCAGAAGATCTGGACGACG
AACGGCGACACCGCCGACTGGGTCTGGCTCGCCGTCCGCACCGACCCCGACGCCCCGCCG
CACAAGGGCATCACCATGCTCCTGGTGCCGACCTCCGACCCCGGCTACTCGTGCACGCTG
ATCAACACACTCGCCTCGCACGACACCACCGCCAGCTACTACGAGAACATCCGGGTCCCC
GTCACCCGCCGGGTCGGCGAGGAGAACAAGGGATGGCGGCTGATCACCAACCAGCTCAAC
CACGAACGCGTGACGCTCGCCGCGCACGGCACCATGGCGATCCGGGCCCTGCACGACGTG
CAGCGCTGGGCCATGGAGACCAAGCTCACCGACGGCCGCCGCGTGGCCGACCTCCCGTGG
GTGCGCCGCCGGCTCGCGCAGACGCACACCCGGCTCGACGCCATGAAGCTGCTCAACTGG
AAGATGGTGAACGCCGTCCAGGAGGGCACCCTCACCCCGCAGGACGCCTCCGCGGTGGTC
GTGAGCATGCTGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR006090 Acyl-CoA oxidase/dehydrogenase, type 1 (Domain)
 [229-318]  1.1e-14 PF00441
PF00441   Acyl-CoA_dh_1
IPR006091 Acyl-CoA oxidase/dehydrogenase, central domain (Domain)
 [123-175]  9e-20 PF02770
PF02770   Acyl-CoA_dh_M
 [122-217]  2.1e-33 G3DSA:2.40.110.10
G3DSA:2.40.110.10   Acyl_CoA_DH/ox_M
IPR006092 Acyl-CoA dehydrogenase, N-terminal (Domain)
 [6-119]  3.09999999999998e-25 PF02771
PF02771   Acyl-CoA_dh_N
IPR009075 Acyl-CoA dehydrogenase/oxidase C-terminal (Domain)
 [218-318]  1.4e-20 G3DSA:1.20.140.10
G3DSA:1.20.140.10   AcylCoA_DH_1/2_C
 [227-319]  1e-13 SSF47203
SSF47203   AcylCoADH_C_like
IPR009100 Acyl-CoA dehydrogenase/oxidase (Domain)
 [2-242]  1.3000049540733e-70 SSF56645
SSF56645   AcylCoA_dehyd_NM
IPR013786 Acyl-CoA dehydrogenase/oxidase, N-terminal (Domain)
 [4-120]  2.7e-31 G3DSA:1.10.540.10
G3DSA:1.10.540.10   AcylCoA_DH/ox_N
SignalP
 [1-30]  0.062 Signal
Eukaryota   
 [1-30]  0.115 Signal
Bacteria, Gram-negative   
 [1-30]  0.128 Signal
Bacteria, Gram-positive   
TMHMM No significant hit