close all open/close all
Polk_00420 Polk_00420   last last

CDS information : Polk_00430


close this sectionLocation

Organism
StrainTü6028
Entry namePolyketomycin
Contig
Start / Stop / Direction51,876 / 52,163 / + [in whole cluster]
51,876 / 52,163 / + [in contig]
Location51876..52163 [in whole cluster]
51876..52163 [in contig]
TypeCDS
Length288 bp (95 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.4 hypothetical protein
Producthypothetical protein(fragment)
Product (GenBank)PokX1
Gene
Gene (GenBank)pokX1
EC number
Keyword
Note
Note (GenBank)
  • unknown function
Reference
ACC
PmId
[19266534] Organisation of the biosynthetic gene cluster and tailoring enzymes in the biosynthesis of the tetracyclic quinone glycoside antibiotic polyketomycin. (Chembiochem. , 2009)

close this sectionSequence

selected fasta
>hypothetical protein(fragment) [PokX1]
MESTFPGDPGLFGPGSVTWQMHGDPMMWVAGIRALYLQALHPRVVRGVTQNSDFRRDAWG
RLMRTANFVGTTTYGTGEAAEKAGARVRKIHSMLTT
selected fasta
>hypothetical protein(fragment) [PokX1]
GTGGAGAGCACGTTCCCGGGCGACCCGGGACTCTTCGGCCCCGGCTCCGTGACCTGGCAG
ATGCACGGCGACCCGATGATGTGGGTCGCCGGCATCCGCGCGCTGTACCTCCAGGCCCTG
CACCCACGCGTCGTGCGCGGGGTGACGCAGAACTCCGACTTCCGGCGCGACGCCTGGGGC
CGGCTGATGCGCACCGCGAACTTCGTCGGCACGACGACGTACGGCACCGGTGAGGCCGCC
GAGAAGGCAGGGGCGAGGGTACGAAAGATTCACAGCATGCTCACGACC

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR018713 Domain of unknown function DUF2236 (Domain)
 [17-94]  8.59999999999998e-25 PF09995
PF09995   DUF2236
SignalP No significant hit
TMHMM No significant hit
Polk_00420 Polk_00420   last last