close all open/close all
first first   Pyolu_00020 Pyolu_00020

CDS information : Pyolu_00010


close this sectionLocation

Organism
StrainPf-5
Entry namePyoluteorin
Contig
Start / Stop / Direction1,666 / 158 / - [in whole cluster]
1,666 / 158 / - [in contig]
Locationcomplement(158..1666) [in whole cluster]
complement(158..1666) [in contig]
TypeCDS
Length1,509 bp (502 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.4 other modification
Productputative halogenase
Product (GenBank)putative halogenase
Gene
Gene (GenBank)pltM
EC number
Keyword
Note
Note (GenBank)
  • contains N-terminal NAD(P)H binding site; PltM
Reference
ACC
PmId
[10094695] Characterization of the pyoluteorin biosynthetic gene cluster of Pseudomonas fluorescens Pf-5. (J Bacteriol. , 1999)
[16162666] Dichlorination of a pyrrolyl-S-carrier protein by FADH2-dependent halogenase PltA during pyoluteorin biosynthesis. (Proc Natl Acad Sci U S A. , 2005)

close this sectionSequence

selected fasta
>putative halogenase [putative halogenase]
MNQYDVIIIGSGIAGALTGAVLAKSGLNVLILDSAQHPRFSVGEAATPESGFLLRLLSKR
FDIPEIAYLSHPDKIIQHVGSSACGIKLGFSFAWHQENAPSSPDHLVAPPLKVPEAHLFR
QDIDYFALMIALKHGAESRQNIKIESISLNDDGVEVALSNAAPVKAAFIIDAAAQGSPLS
RQLGLRTTEGLATDTCSFFTHMLNVKSYEDALAPLSRTRSPIELFKSTLHHIFEEGWLWV
IPFNNHPQGTNQLCSIGFQFNNAKYRPTEAPEIEFRKLLKKYPAIGEHFKDAVNAREWIY
APRINYRSVQNVGDRFCLLPQATGFIDPLFSRGLITTFESILRLAPKVLDAARSNRWQRE
QFIEVERHCLNAVATNDQLVSCSYEAFSDFHLWNVWHRVWLSGSNLGSAFLQKLLHDLEH
SGDARQFDAALEAVRFPGCLSLDSPAYESLFRQSCQVMQQAREQARPVAETANALHELIK
EHEAELLPLGYSRISNRFILKV
selected fasta
>putative halogenase [putative halogenase]
ATGAATCAGTACGACGTCATTATCATCGGTAGTGGTATCGCCGGCGCGCTGACCGGCGCC
GTCCTCGCGAAGTCCGGGCTGAACGTTCTGATCCTCGACTCGGCCCAGCACCCACGATTC
TCCGTCGGCGAAGCGGCGACACCGGAAAGCGGTTTTCTGCTGCGTTTGCTCTCAAAGCGC
TTCGACATCCCTGAAATCGCCTACCTCTCGCACCCCGACAAGATCATCCAGCACGTCGGT
TCGAGCGCCTGCGGGATCAAGCTGGGCTTCAGTTTTGCCTGGCATCAAGAGAACGCGCCG
TCGTCCCCCGACCACCTTGTGGCCCCGCCGCTGAAGGTGCCGGAAGCCCATCTTTTCCGG
CAGGACATCGACTATTTCGCCCTGATGATTGCCCTGAAACACGGCGCCGAATCCAGACAG
AACATCAAGATCGAGTCGATCAGCCTCAACGACGACGGGGTCGAGGTGGCATTGTCCAAC
GCCGCCCCCGTCAAGGCCGCGTTCATCATTGACGCTGCTGCCCAGGGCTCTCCGCTTTCC
CGCCAACTGGGCTTGCGCACCACCGAAGGGCTGGCGACCGACACCTGCTCATTCTTCACC
CACATGCTCAATGTGAAGAGCTACGAAGATGCCCTGGCTCCGTTGTCCCGCACTCGTTCC
CCCATCGAACTGTTCAAGAGCACCTTGCACCACATCTTCGAAGAGGGCTGGTTGTGGGTC
ATCCCCTTCAACAACCACCCGCAGGGCACCAATCAGTTGTGCAGCATCGGCTTCCAGTTC
AACAACGCCAAGTACCGTCCCACCGAGGCGCCGGAGATCGAGTTTCGCAAACTGCTGAAA
AAGTACCCGGCCATCGGCGAACACTTCAAGGATGCGGTCAATGCCCGGGAGTGGATCTAC
GCGCCGCGCATCAACTACCGCAGCGTGCAAAATGTCGGGGATCGCTTCTGCCTGCTGCCG
CAAGCCACAGGGTTTATCGACCCGCTGTTCTCCAGGGGGTTGATCACCACCTTCGAGTCC
ATCCTCAGGCTGGCCCCCAAGGTGCTGGACGCCGCCCGCAGCAACCGCTGGCAACGGGAA
CAGTTCATCGAAGTCGAGCGCCATTGCCTGAACGCGGTGGCGACCAATGACCAGTTGGTC
TCCTGCTCCTATGAAGCCTTCAGCGACTTTCACCTGTGGAACGTGTGGCATCGGGTCTGG
CTCAGCGGCTCCAACCTGGGCAGTGCCTTTCTGCAAAAGCTGCTGCACGACCTGGAACAC
AGTGGCGACGCCCGCCAGTTCGATGCAGCGCTTGAGGCGGTGCGCTTCCCTGGCTGCCTG
TCCCTGGACTCGCCCGCCTACGAAAGCCTGTTCAGGCAGTCGTGCCAGGTCATGCAACAG
GCCAGGGAGCAAGCCAGGCCGGTGGCCGAAACCGCCAACGCGCTGCATGAGCTGATCAAG
GAGCACGAAGCCGAGTTGTTGCCCCTGGGCTATTCACGGATATCCAATCGTTTCATCCTC
AAAGTCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR006905 Tryptophan halogenase (Family)
 [5-70]  3.7e-06 PF04820
PF04820   Trp_halogenase
SignalP
 [1-23]  0.928 Signal
Bacteria, Gram-negative   
TMHMM
 [7-29]  Transmembrane (i-o)
Transmembrane 1   
first first   Pyolu_00020 Pyolu_00020