close all open/close all

CDS information : Pyolu_00020


close this sectionLocation

Organism
StrainPf-5
Entry namePyoluteorin
Contig
Start / Stop / Direction2,694 / 1,663 / - [in whole cluster]
2,694 / 1,663 / - [in contig]
Locationcomplement(1663..2694) [in whole cluster]
complement(1663..2694) [in contig]
TypeCDS
Length1,032 bp (343 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category4.1 transcriptional regulator
ProductLysR family transcriptional activator
Product (GenBank)transcriptional activator of pyoluteorin biosynthetic genes
Gene
Gene (GenBank)pltR
EC number
Keyword
Note
Note (GenBank)
  • contains N-terminal helix-turn-helix binding motif; PltR
Reference
ACC
PmId
[10094695] Characterization of the pyoluteorin biosynthetic gene cluster of Pseudomonas fluorescens Pf-5. (J Bacteriol. , 1999)
[27148187] The Rare Codon AGA Is Involved in Regulation of Pyoluteorin Biosynthesis in Pseudomonas protegens Pf-5. (Front Microbiol. , 2016)
Related Reference
ACC
Q6TLK2
PmId
[17653674] LysR family factor PltR positively regulates Pyoluteorin production in a pathway-specific manner in Pseudomonas sp. M18. (Sci China C Life Sci. , 2007)
[18248796] PltR expression modulated by the global regulators GacA, RsmA, LasI and RhlI in Pseudomonas sp. M18. (Res Microbiol. , 2008)
[22761817] Transcriptional Activation of Pyoluteorin Operon Mediated by the LysR-Type Regulator PltR Bound at a 22 bp lys Box in Pseudomonas aeruginosa M18. (PLoS One. , 2012)

close this sectionSequence

selected fasta
>LysR family transcriptional activator [transcriptional activator of pyoluteorin biosynthetic genes]
MKALGVVNDIDLYISVTKTGSFSETGRLLGIPPSSVMRRINSLEKELETCLFNRSTKCLI
LTETGLLFLEHAKNISRCIGHARSEVKEHTASTLGVLKVSAPVAFGRRHVAPLLSRILNH
HPGLKIEFSLNDKALDPSIDNVDICIKLGILPDSNLIPTKLADMRRVLCASPEYIRQHGC
PQTLEDLYQHACLIHSTCSNFSLTWQFKVDGLLKKLMPSSRLSVNSSELLVDGALQGIGI
IHAPTWLVHEQIASGQLVSLLDEYCEADPQQGAIYALRARSSVVPAKTRLFINELKRSIG
STPYWDLPFEKEIPQTLATLHFDTAMHSALSRATTLQDKSQTS
selected fasta
>LysR family transcriptional activator [transcriptional activator of pyoluteorin biosynthetic genes]
ATGAAGGCGCTAGGCGTTGTCAATGACATAGACCTTTATATATCCGTAACTAAAACGGGT
AGTTTCTCCGAAACAGGAAGACTACTTGGCATCCCACCTTCTTCGGTGATGCGCAGAATC
AATAGCCTCGAAAAAGAACTTGAAACCTGTCTATTCAATCGATCGACAAAATGCTTGATA
CTTACCGAAACAGGCCTGCTCTTTCTCGAACATGCAAAGAACATCTCGAGATGCATTGGG
CATGCTAGATCAGAAGTAAAAGAACACACTGCATCGACCCTTGGCGTTCTCAAGGTTTCA
GCACCCGTGGCCTTTGGACGGCGCCATGTAGCGCCTTTATTGAGCAGAATACTGAACCAT
CATCCCGGTTTGAAAATTGAATTCTCGCTTAACGACAAAGCTCTCGACCCCAGCATCGAT
AACGTCGATATCTGTATCAAGCTGGGCATATTGCCGGACAGTAATCTGATTCCAACGAAA
CTTGCGGATATGCGGCGCGTGCTCTGCGCAAGCCCGGAATACATCCGGCAACACGGCTGT
CCGCAAACTCTTGAAGACCTGTACCAACATGCCTGCCTGATCCACAGCACCTGCAGCAAC
TTCTCACTGACCTGGCAATTCAAGGTCGATGGCCTGCTCAAGAAGCTCATGCCCAGCAGC
CGGCTATCGGTCAACAGTTCCGAGTTGCTGGTGGACGGCGCCCTTCAGGGCATAGGAATC
ATCCACGCGCCCACCTGGCTGGTGCATGAACAGATCGCCAGCGGCCAACTGGTGTCGCTG
CTCGACGAATATTGCGAGGCCGATCCGCAACAGGGAGCGATCTACGCACTGAGGGCACGC
AGCAGCGTTGTCCCGGCCAAGACCCGCCTGTTCATCAATGAGTTGAAACGCTCGATCGGC
AGCACGCCTTACTGGGACTTGCCGTTTGAAAAGGAAATACCGCAGACCCTGGCCACCCTG
CATTTCGATACCGCAATGCATTCAGCGCTTTCCAGAGCGACCACCTTGCAAGACAAGAGC
CAGACATCATGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000847 Transcription regulator HTH, LysR (Domain)
 [8-65]  2.3e-12 PF00126
PF00126   HTH_1
 [1-62]  12.773 PS50931
PS50931   HTH_LYSR
IPR005119 LysR, substrate-binding (Domain)
 [95-298]  6.5e-31 PF03466
PF03466   LysR_substrate
IPR011991 Winged helix-turn-helix transcription repressor DNA-binding (Domain)
 [9-89]  7.1e-15 G3DSA:1.10.10.10
G3DSA:1.10.10.10   no description
SignalP No significant hit
TMHMM No significant hit