close all open/close all

CDS information : Pyolu_00030


close this sectionLocation

Organism
StrainPf-5
Entry namePyoluteorin
Contig
Start / Stop / Direction3,180 / 3,446 / + [in whole cluster]
3,180 / 3,446 / + [in contig]
Location3180..3446 [in whole cluster]
3180..3446 [in contig]
TypeCDS
Length267 bp (88 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category1.4 Other
Productpeptidyl carrier protein
Product (GenBank)PltL
Gene
Gene (GenBank)pltL
EC number
Keyword
  • pyrrole ring moiety
Note
Note (GenBank)
  • similar to acyl carrier proteins
Reference
ACC
PmId
[10094695] Characterization of the pyoluteorin biosynthetic gene cluster of Pseudomonas fluorescens Pf-5. (J Bacteriol. , 1999)
[11880032] Conversion of L-proline to pyrrolyl-2-carboxyl-S-PCP during undecylprodigiosin and pyoluteorin biosynthesis. (Chem Biol. , 2002)
[26340431] Structure and Substrate Sequestration in the Pyoluteorin Type II Peptidyl Carrier Protein PltL. (J Am Chem Soc. , 2015)

close this sectionPKS/NRPS Module

0
PCP9..66

close this sectionSequence

selected fasta
>peptidyl carrier protein [PltL]
MDGEEVKEKIRRYIMEDLIGPSAKEDELDDQTPLLEWGILNSMNIVKLMVYIRDEMGVSI
PSTHITGKYFKDLNAISRTVEQLKAECA
selected fasta
>peptidyl carrier protein [PltL]
ATGGACGGAGAGGAAGTTAAAGAAAAGATTCGTCGCTACATCATGGAAGATTTGATCGGG
CCAAGTGCAAAGGAAGATGAGCTTGATGACCAGACTCCACTACTGGAGTGGGGCATTCTC
AACTCGATGAATATCGTCAAGCTCATGGTCTACATCAGGGATGAAATGGGTGTCTCGATT
CCAAGTACCCATATCACCGGAAAATATTTTAAAGACCTGAATGCAATATCCAGGACTGTC
GAGCAACTAAAGGCCGAGTGCGCCTAA
[0] PCP9..66
[0] PCP25..198

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR009081 Acyl carrier protein-like (Domain)
 [2-84]  7e-10 SSF47336
SSF47336   ACP-like
 [4-83]  1.9e-11 G3DSA:1.10.1200.10
G3DSA:1.10.1200.10   no description
 [9-66]  1.6e-07 PF00550
PF00550   PP-binding
SignalP No significant hit
TMHMM No significant hit