close all open/close all

CDS information : Pyolu_00040


close this sectionLocation

Organism
StrainPf-5
Entry namePyoluteorin
Contig
Start / Stop / Direction3,460 / 4,809 / + [in whole cluster]
3,460 / 4,809 / + [in contig]
Location3460..4809 [in whole cluster]
3460..4809 [in contig]
TypeCDS
Length1,350 bp (449 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.2 modification addition of starter unit
ProductFADH2-dependent L-pyrrolyl-PCP halogenase
Product (GenBank)putative halogenase
Gene
Gene (GenBank)pltA
EC number
Keyword
  • dichlorination
  • pyrrole ring moiety
Note
Note (GenBank)
  • contains N-terminal NAD(P)H binding site; PltA
Reference
ACC
PmId
[10094695] Characterization of the pyoluteorin biosynthetic gene cluster of Pseudomonas fluorescens Pf-5. (J Bacteriol. , 1999)
[16162666] Dichlorination of a pyrrolyl-S-carrier protein by FADH2-dependent halogenase PltA during pyoluteorin biosynthesis. (Proc Natl Acad Sci U S A. , 2005)
[26416533] Crystal structure of halogenase PltA from the pyoluteorin biosynthetic pathway. (J Struct Biol. , 2015)

close this sectionSequence

selected fasta
>FADH2-dependent L-pyrrolyl-PCP halogenase [putative halogenase]
MSDHDYDVVIIGGGPAGSTMASYLAKAGVKCAVFEKELFEREHVGESLVPATTPVLLEIG
VMEKIEKANFPKKFGAAWTSADSGPEDKMGFQGLDHDFRSAEILFNERKQEGVDRDFTFH
VDRGKFDRILLEHAGSLGAKVFQGVEIADVEFLSPGNVIVNAKLGKRSVEIKAKMVVDAS
GRNVLLGRRLGLREKDPVFNQFAIHSWFDNFDRKSATQSPDKVDYIFIHFLPMTNTWVWQ
IPITETITSVGVVTQKQNYTNSDLTYEEFFWEAVKTRENLHDALKASEQVRPFKKEADYS
YGMKEVCGDSFVLIGDAARFVDPIFSSGVSVALNSARIASGDIIEAVKNNDFSKSSFTHY
EGMIRNGIKNWYEFITLYYRLNILFTAFVQDPRYRLDILQLLQGDVYSGKRLEVLDKMRE
IIAAVESDPEHLWHKYLGDMQVPTAKPAF
selected fasta
>FADH2-dependent L-pyrrolyl-PCP halogenase [putative halogenase]
ATGAGCGATCATGATTATGATGTAGTGATTATCGGTGGCGGGCCGGCGGGTTCGACCATG
GCCTCCTACCTGGCAAAAGCCGGTGTCAAATGCGCGGTGTTCGAAAAAGAACTGTTCGAG
CGCGAGCATGTTGGCGAGTCGCTGGTACCGGCCACCACTCCGGTGCTGCTGGAAATCGGG
GTGATGGAAAAGATCGAGAAAGCCAACTTCCCGAAGAAGTTCGGCGCTGCCTGGACCTCG
GCAGATTCCGGCCCCGAAGACAAGATGGGCTTCCAGGGGCTGGACCACGATTTCCGTTCG
GCGGAAATCCTCTTCAACGAGCGCAAGCAGGAAGGGGTCGATCGCGACTTCACGTTCCAC
GTCGACCGCGGCAAGTTCGACCGCATTCTTCTGGAGCACGCAGGTTCGCTGGGGGCCAAG
GTCTTCCAGGGCGTGGAGATCGCTGACGTCGAGTTTCTCAGCCCGGGCAATGTCATTGTC
AATGCCAAGCTGGGCAAGCGCAGCGTGGAGATCAAGGCCAAGATGGTGGTGGATGCCAGC
GGTCGCAACGTGCTGCTGGGCCGCCGGCTGGGCTTGCGAGAAAAGGACCCGGTCTTCAAC
CAGTTCGCGATTCACTCCTGGTTCGACAACTTCGACCGCAAGTCGGCGACGCAAAGCCCG
GACAAGGTCGACTACATCTTCATTCACTTCCTGCCGATGACCAATACCTGGGTCTGGCAG
ATCCCGATCACCGAAACCATTACCAGCGTGGGCGTGGTTACGCAGAAGCAGAACTACACC
AACTCCGACCTCACCTATGAAGAGTTCTTCTGGGAAGCGGTGAAGACCCGGGAAAACCTG
CATGACGCGCTGAAGGCATCGGAGCAGGTCCGCCCGTTCAAGAAAGAGGCGGACTACAGC
TACGGCATGAAAGAAGTCTGTGGCGACAGCTTCGTGCTGATCGGCGATGCCGCACGGTTC
GTCGACCCGATCTTCTCCAGCGGCGTCAGCGTTGCACTCAACAGTGCGCGCATCGCCAGC
GGCGACATCATCGAGGCGGTGAAGAACAACGACTTTAGCAAGTCCAGTTTCACTCACTAC
GAAGGCATGATCAGGAATGGCATCAAGAACTGGTATGAGTTCATCACGCTCTATTACCGC
CTGAACATCCTCTTCACCGCGTTCGTTCAAGACCCACGCTACCGCCTGGACATCCTGCAA
TTGCTGCAAGGGGACGTCTACAGCGGCAAGCGCCTGGAAGTGCTGGACAAGATGCGCGAA
ATCATCGCTGCGGTTGAAAGCGACCCGGAACACCTCTGGCACAAGTACCTGGGCGACATG
CAGGTTCCTACCGCCAAACCCGCGTTCTAA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR003042 Aromatic-ring hydroxylase-like (Domain)
 [7-29]  7e-09 PR00420 [308-323]  7e-09 PR00420
PR00420   RNGMNOXGNASE
IPR006905 Tryptophan halogenase (Family)
 [115-382]  1.8e-18 PF04820
PF04820   Trp_halogenase
IPR023753 Pyridine nucleotide-disulphide oxidoreductase, FAD/NAD(P)-binding domain (Domain)
 [7-85]  7.6e-07 PF07992
PF07992   Pyr_redox_2
SignalP No significant hit
TMHMM No significant hit