close all open/close all

CDS information : Pyolu_00050


close this sectionLocation

Organism
StrainPf-5
Entry namePyoluteorin
Contig
Start / Stop / Direction4,842 / 12,218 / + [in whole cluster]
4,842 / 12,218 / + [in contig]
Location4842..12218 [in whole cluster]
4842..12218 [in contig]
TypeCDS
Length7,377 bp (2,458 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category1.1 PKS
Productpolyketide synthase
Product (GenBank)polyketide synthase type I
Gene
Gene (GenBank)pltB
EC number
Keyword
  • resorcinol ring moiety
Note
Note (GenBank)
  • modules 1 and 2; PltB
Reference
ACC
PmId
[10094695] Characterization of the pyoluteorin biosynthetic gene cluster of Pseudomonas fluorescens Pf-5. (J Bacteriol. , 1999)
[9434161] Identification and sequence analysis of the genes encoding a polyketide synthase required for pyoluteorin biosynthesis in Pseudomonas fluorescens Pf-5. (Gene. , 1997)

close this sectionPKS/NRPS Module

1 malonyl-CoA
2 malonyl-CoA
KS10..383
AT535..843
ACP941..1010
KS1034..1398
AT1699..2060
kr2198..2236
ACP2339..2409

close this sectionSequence

selected fasta
>polyketide synthase [polyketide synthase type I]
MDARAPMDFEPIAIIGSGCRFAKGASTPEAFWELLRAGTDFVGPVPAERWDTAAIYDESA
AETGTTYSKVGAFLEHIDRFDAHYFGISASEAKEMDPQQRLLLEVACESVARAGLTREQL
KGSRTAVYVGMLGMDYLALHSREAGIEQINPYYAAGKEFSFAAGRIAYHLGVHGPAMTVT
TACSSSLVAMHLACRALQAGEADMALAGGVNLMLAPDLTIYMSQIRAISPSGRCRVFDAA
ADGIVRGEGCGVTVLKRLADALRDGDPIQAVIRGSAINQDGASAGQTVPNANAQAAVISQ
ALKVAGLSVDDIDYVEAHGTGTPLGDPIELSSLDSAFQGRERPLWVGSVKANMGHLDAAA
GMASVIKTMMVLKHAEVPAQLHLAQLNPLVDWKRSRLAVPTAIESLPDRPRLAGISGFGL
SGTNVHMILEDASVYRQAQPQQERSAQGRPWVLPVSARSAQAVVEQARAYAVHLPQQDDG
QLQAFVASAIHRRDHFPYRSAVVGANAGQLKSQLEQLPAPTLACTTDEEDRRGPVLVFTG
QGAQWVGMGRDLLEREPAFLAMIRRCDQALAQWASWSVEAELRSDASGSRLHLTEFAQPC
IFAIQVAISECLRQWGVIPAAVVGHSMGEVAAAYCAGALDLESAVRVIHHRAQAMKDTLG
QGRMLVVGLPAPTLQSRLANNPQLELSVVNSRNSCVVSGSPQAVQALDQQLRDEGIFTYL
MPAEYAFHSCQMDECLTQIRAGLEDLPVVAAHTPWISTSAMPEEPILADADYWARNARGI
VRFDRAIEQLIEQGHRLFVEIGPHTVLAASINQALADKGTQGLVCGALHKQGDAALELAS
IVARLYEWGAGPDWQAFQPREAALELPAYPWQQERFWFAPAPRPQPAGLVSQLRAQVLVY
DAQGNLCAQANDVALSVPQLAQVAVPAPAKVSAAAQPVGDVRAQIGALLTQIIGVACADP
DPDRGFFELGLSSISLVEFKRMLERQFALKLSATVGFDYPTINRLGQYLEGLLSREPAST
PVTVDAGATDAAGSVAVVAMACRFPQADSPEALWKLMLEQTDTVGPVPPSRLAGAKPEET
FPRFASLIQRPEGFDEAFFRISPKEARSMDPQQRLLLMVAWEALERAGIPQEKLLEQRVG
VFVGANSHDYETRVLGSAQGVDAHYGTGSSFSAICGRLSHFLGVRGPSLTVDTACSSSLT
AIHLACNSLRAAECDIAIVGGVNVIASASIFQSMGQAGALAPDGISKAFDDSADGYGRGE
GCGVVILKRQAQAERERDPIVATILGSAVNHDGACAGLTVPNGPAQEALISEALANAGVH
PGQVSYVEAHGTGTVLGDPIELNALHNAYRQASPDSPPLTVASVKANIGHLEAAAGIASL
IKACLVVEHGRIAPQAHLQRANTRVDWAAMNLKLAHQAMDWPGRPESRVAGVSAFGFTGT
NVHVLLKGYTAPATAPLPPATAPVALCLSAATPAALAELAQRYVSFLGATEHCPQTICYN
ALMRRTAFKERLVVHGQDCRELAQALQAWLAGSPIANDRKPAAGEPWATLAEAFGRGAQS
PGPERLPDGCQAIGLPTYPWQLNDYWIDAGQPATAVQPARAASGHPCLQGLVRPAGQLWY
WSGALAPQAGHYDPLGEQGYRVKTHLLLDAVLQAVRETPRGVQQIRDLQIAQLRLRGEQH
LTSHLSIHLTQAPDACFELALQGAGDERRQVCMSGTLVDCAAQLQEETLCGVSMLDEPSP
PAPDVGLCPWSGCAATGGQRALYRFAHSLTAAERQTQLLASVVELFEGAHAAALVGFSGL
QVWADLPAQVWIVLAGHDADKPDSLQVVDARGCQLALFEGPQFGHPGSWYLPDLQTAPLD
LPMIARQWQDYPMPGEGARQREGYWMVLAWSTAEVQPLAAAFAAEQRPVEVIELHAGQQP
LARKLSSALRGAVADPSCLGVIVAGVEAQEADGLGISLVASAALVQAFAGAIASVGTPAK
PVWFALHASDAASPAMAAVQATWQGAAHIFALEHPAWWGGLVTLQGSDRRSYASLCRLLH
GQPGHDHFAISGARVEVQYLVEDQADPLQRLEPPALNGTVVLHAVPGSDLETVLTALGQR
GVQRVLLLCEAPGQLHMPERMPEAMAISSLSDLSRENLADTFATLRAQDRIAGFIHLDLD
WRTVALKEPEFVVRMQEGVRPLEVLQQVHQLIDDPEAFFLILGSVSSLLGGAGFARSAIA
DAYALWVHAQRRRQGLNCQLLHLTQSEQELEQDAAARTAMQGSGLQPLQRSQIVQAIARV
LGGQGQCGLLNVDWQQLKGLYLSVLPWPLLEHLGAADSAADQRLAELIGLPPLQQRRAMQ
ALVCEVVGQVFGVADGLELDVRKGFFDMGMSSVMSLDLRSRLGRALSIDLPSTFGFEYTS
IEQVTDYLMGQLLAPETREPVAAPEPVSPASRHQDLHELSRAELIGALEDELRDIANY
selected fasta
>polyketide synthase [polyketide synthase type I]
ATGGATGCTCGTGCGCCCATGGATTTTGAACCCATTGCAATCATCGGGAGTGGATGCCGC
TTTGCCAAAGGTGCATCGACCCCCGAGGCATTCTGGGAGCTCCTTCGTGCTGGGACCGAT
TTTGTCGGACCGGTTCCCGCAGAGCGCTGGGACACAGCGGCGATCTACGATGAGAGCGCT
GCTGAAACCGGTACGACCTACAGCAAGGTGGGGGCGTTCCTCGAGCACATCGATCGCTTC
GATGCGCATTACTTTGGCATCTCGGCCTCTGAAGCCAAGGAAATGGACCCCCAGCAGCGC
CTGCTGCTGGAGGTCGCCTGTGAAAGCGTGGCCCGTGCCGGCCTGACCCGCGAGCAGCTC
AAAGGCAGCAGGACCGCGGTCTATGTCGGCATGCTGGGCATGGATTACCTGGCACTGCAC
TCCCGCGAGGCCGGCATCGAACAGATCAACCCCTACTATGCCGCCGGCAAGGAATTCAGC
TTCGCCGCCGGGCGTATTGCCTACCACCTGGGTGTTCATGGGCCGGCAATGACCGTGACC
ACTGCATGCTCTTCTTCCCTGGTGGCCATGCACCTGGCCTGTCGCGCCTTGCAGGCAGGG
GAGGCGGACATGGCCCTGGCCGGAGGGGTGAACCTGATGCTGGCGCCGGACCTGACGATC
TACATGAGCCAGATCAGGGCGATCTCGCCCAGTGGTCGCTGCCGGGTATTCGATGCGGCG
GCCGACGGGATCGTCCGGGGCGAAGGCTGCGGGGTCACGGTGCTCAAGCGCCTGGCAGAT
GCCCTACGCGATGGCGATCCGATCCAGGCGGTGATCAGGGGCTCGGCGATCAACCAGGAT
GGCGCCAGTGCCGGCCAGACCGTGCCCAACGCCAATGCCCAGGCTGCAGTGATCAGCCAG
GCCCTGAAAGTGGCCGGCTTGAGCGTGGACGACATCGACTATGTCGAGGCCCACGGCACC
GGTACGCCCCTGGGCGATCCGATCGAACTCTCTTCGCTGGACAGTGCCTTCCAGGGGCGT
GAGCGGCCGCTGTGGGTGGGCTCGGTCAAGGCCAACATGGGCCATCTGGATGCGGCCGCC
GGAATGGCCAGCGTGATCAAGACCATGATGGTTCTCAAGCACGCCGAGGTGCCTGCGCAA
CTGCATCTTGCACAGTTGAACCCACTGGTGGACTGGAAGCGTTCCCGGCTGGCGGTGCCC
ACGGCGATCGAGTCGTTGCCCGACCGGCCGCGCCTGGCTGGAATCAGTGGTTTCGGGCTC
AGTGGCACCAACGTCCACATGATTCTCGAAGATGCCAGCGTCTATCGGCAGGCACAGCCG
CAGCAGGAACGATCGGCACAGGGCCGGCCCTGGGTCCTGCCGGTATCGGCCAGGTCCGCG
CAGGCCGTGGTGGAGCAGGCCAGGGCCTATGCCGTTCATCTGCCGCAGCAGGACGATGGG
CAATTGCAAGCCTTTGTCGCCAGCGCCATTCATCGTCGTGATCACTTTCCCTACCGGTCG
GCCGTGGTGGGTGCGAACGCCGGGCAATTGAAGAGCCAGCTGGAGCAGCTGCCGGCCCCG
ACCTTGGCCTGCACGACGGACGAAGAGGATCGGCGCGGGCCCGTGCTGGTGTTTACCGGG
CAGGGCGCCCAGTGGGTGGGAATGGGCCGCGACCTGCTTGAACGGGAGCCGGCCTTCCTG
GCGATGATCCGGCGTTGCGACCAGGCGCTGGCCCAGTGGGCAAGCTGGTCGGTGGAGGCC
GAGCTGCGCAGCGACGCCAGTGGGTCCCGCCTGCACCTGACCGAATTTGCCCAGCCCTGC
ATCTTTGCCATCCAGGTGGCGATCAGTGAATGCCTGCGCCAGTGGGGTGTGATCCCGGCG
GCGGTGGTCGGCCACTCCATGGGGGAAGTGGCCGCGGCCTATTGCGCCGGAGCACTGGAC
CTGGAGTCGGCGGTGCGGGTCATCCACCATCGGGCCCAGGCCATGAAGGACACCCTGGGG
CAGGGGCGGATGCTGGTGGTGGGCTTGCCCGCGCCGACGCTCCAGTCGCGTCTGGCGAAC
AACCCGCAACTGGAACTGTCGGTGGTCAACAGTCGAAACAGCTGTGTGGTGTCCGGTAGC
CCGCAGGCTGTACAGGCTCTGGATCAGCAACTGCGTGACGAAGGCATCTTCACTTACCTG
ATGCCGGCGGAATATGCCTTCCACTCCTGCCAGATGGATGAGTGCCTGACGCAGATCCGC
GCGGGGCTGGAGGATTTGCCGGTGGTTGCCGCGCACACGCCCTGGATTTCCACCAGCGCG
ATGCCCGAGGAGCCGATCCTGGCAGATGCCGACTACTGGGCGAGGAATGCCCGTGGCATC
GTGCGCTTCGATCGCGCCATCGAACAGTTGATCGAGCAGGGGCACCGGCTGTTCGTCGAG
ATCGGCCCGCACACCGTGTTGGCGGCGTCGATCAACCAGGCCCTGGCCGACAAGGGAACC
CAGGGACTGGTGTGCGGCGCCTTGCACAAGCAGGGCGACGCCGCCCTGGAGCTGGCCAGT
ATTGTTGCCCGCCTGTACGAGTGGGGCGCAGGTCCCGACTGGCAAGCCTTCCAACCCAGG
GAGGCGGCGCTGGAGCTGCCGGCCTATCCCTGGCAGCAGGAGCGTTTCTGGTTTGCCCCG
GCGCCGCGGCCGCAGCCGGCAGGGCTCGTGTCCCAGCTGCGGGCGCAGGTACTGGTGTAT
GACGCCCAGGGCAATCTCTGCGCCCAGGCCAACGATGTGGCGCTGAGCGTGCCGCAGCTG
GCACAAGTCGCTGTGCCGGCACCGGCCAAGGTGTCCGCAGCGGCGCAGCCGGTGGGGGAT
GTGCGGGCGCAGATTGGTGCACTGCTGACGCAGATCATCGGCGTGGCCTGTGCCGACCCG
GACCCGGATCGAGGCTTCTTCGAACTGGGCCTGAGCTCGATTTCCCTGGTTGAATTCAAG
CGCATGCTGGAGCGCCAGTTCGCCCTCAAGCTGTCGGCGACCGTGGGCTTCGACTATCCC
ACCATCAACCGGCTGGGCCAGTACCTGGAAGGGCTGCTGTCCCGGGAGCCGGCCAGCACC
CCGGTAACGGTCGATGCCGGGGCGACCGACGCCGCGGGGAGCGTCGCCGTGGTGGCCATG
GCGTGCCGGTTTCCCCAGGCCGACAGCCCCGAGGCACTCTGGAAGCTGATGCTGGAACAG
ACGGACACCGTGGGGCCGGTACCGCCGTCCCGGCTCGCCGGCGCTAAGCCGGAGGAAACC
TTCCCGCGGTTTGCCAGCCTTATCCAGCGCCCCGAAGGGTTCGACGAAGCGTTCTTCCGC
ATTTCCCCCAAGGAAGCCCGGAGCATGGACCCCCAGCAACGGCTGTTGCTGATGGTGGCC
TGGGAGGCTCTGGAACGGGCCGGTATCCCTCAGGAGAAGCTGCTGGAACAGAGGGTCGGG
GTGTTTGTCGGGGCCAACTCCCACGACTACGAAACCCGGGTCCTGGGTAGCGCGCAAGGC
GTGGATGCCCACTACGGCACTGGCAGTTCGTTTTCGGCGATCTGCGGGCGCCTCTCGCAT
TTTCTCGGCGTGCGTGGGCCGAGCCTGACGGTGGACACCGCATGCTCGTCATCGCTCACG
GCCATCCATCTGGCGTGCAACAGCTTGCGTGCCGCGGAGTGCGACATCGCGATTGTGGGT
GGGGTGAATGTCATCGCCTCGGCGTCGATCTTTCAATCCATGGGGCAGGCCGGCGCATTG
GCCCCGGACGGCATCAGCAAGGCCTTCGACGACAGTGCCGACGGTTACGGTCGAGGGGAG
GGCTGCGGCGTGGTCATTCTCAAGCGCCAGGCCCAGGCCGAGCGGGAGCGTGACCCGATT
GTCGCGACGATTCTCGGTTCGGCGGTCAATCACGACGGTGCCTGTGCCGGGCTGACAGTG
CCCAATGGTCCGGCGCAAGAGGCGCTGATCAGCGAAGCACTGGCCAACGCCGGCGTGCAT
CCGGGGCAAGTCAGCTACGTGGAGGCCCATGGCACCGGCACGGTGCTGGGTGACCCCATC
GAGCTCAACGCCCTGCACAACGCCTATCGCCAGGCCAGCCCCGACAGTCCGCCGCTGACG
GTGGCCTCGGTCAAGGCCAATATCGGGCACCTCGAGGCGGCAGCGGGCATCGCTTCGCTG
ATCAAGGCCTGCCTGGTGGTGGAGCACGGCCGGATTGCCCCGCAAGCCCATCTGCAGCGG
GCCAACACCCGTGTCGACTGGGCGGCCATGAACCTCAAGCTGGCGCATCAGGCCATGGAC
TGGCCGGGCCGGCCGGAGTCGCGGGTGGCCGGGGTCAGTGCCTTTGGTTTCACCGGGACC
AACGTGCATGTGCTGCTCAAGGGCTATACGGCGCCCGCGACAGCGCCTTTGCCACCCGCC
ACAGCACCAGTGGCCTTGTGCCTGTCCGCGGCCACCCCGGCGGCATTGGCGGAGCTGGCC
CAGCGCTATGTGTCCTTCCTGGGCGCTACCGAGCACTGCCCACAGACCATCTGCTACAAC
GCGCTGATGCGGCGCACGGCGTTCAAGGAACGCCTGGTCGTCCACGGCCAGGATTGCCGC
GAGCTGGCTCAGGCACTACAGGCCTGGCTGGCCGGTAGCCCCATCGCCAATGACCGCAAA
CCCGCGGCCGGCGAACCCTGGGCAACCCTGGCCGAGGCCTTTGGCCGCGGCGCCCAGTCG
CCGGGCCCCGAGCGCTTGCCGGACGGCTGTCAGGCCATCGGGTTGCCCACCTATCCCTGG
CAGCTCAACGACTACTGGATCGATGCTGGCCAGCCGGCTACGGCGGTGCAGCCCGCCCGG
GCAGCCTCGGGCCATCCTTGCCTGCAGGGGCTGGTACGGCCGGCCGGGCAGCTCTGGTAC
TGGTCGGGGGCTCTCGCTCCCCAGGCCGGGCATTACGACCCGCTGGGCGAGCAGGGGTAC
AGGGTCAAGACTCACCTGTTGCTGGATGCCGTGCTCCAGGCGGTGCGGGAAACACCACGG
GGCGTGCAGCAGATCCGCGACTTGCAGATTGCCCAGCTGCGCCTGCGCGGCGAACAGCAC
CTCACTTCGCACCTGAGCATCCACCTCACCCAGGCGCCTGACGCCTGCTTCGAACTGGCC
TTGCAAGGGGCCGGCGACGAGCGCCGCCAGGTCTGCATGAGCGGAACCCTGGTTGACTGT
GCAGCGCAGTTGCAGGAGGAAACCCTGTGCGGGGTGTCGATGCTCGATGAGCCTTCACCG
CCGGCGCCGGACGTTGGCCTGTGCCCATGGTCCGGGTGTGCGGCCACGGGCGGGCAGCGG
GCCTTGTACCGTTTTGCCCACTCCCTGACGGCGGCCGAGCGCCAGACCCAGTTGCTGGCC
AGTGTGGTCGAGCTGTTTGAAGGCGCCCACGCCGCCGCGCTGGTCGGGTTCTCCGGGCTC
CAGGTATGGGCAGACCTGCCGGCGCAGGTATGGATTGTGCTGGCCGGCCATGACGCCGAC
AAACCCGACAGCCTGCAGGTAGTGGATGCCCGGGGTTGCCAGCTGGCGCTGTTCGAAGGT
CCGCAGTTTGGCCATCCTGGTTCGTGGTACTTGCCCGACCTCCAGACCGCACCCCTCGAC
CTGCCGATGATCGCTCGCCAATGGCAGGACTATCCGATGCCGGGCGAGGGCGCTCGGCAA
CGCGAGGGCTACTGGATGGTGCTGGCCTGGAGCACTGCCGAGGTCCAGCCACTGGCTGCG
GCGTTTGCGGCTGAACAGCGTCCGGTTGAAGTCATCGAGCTGCACGCCGGGCAACAACCT
CTGGCCCGCAAACTGTCCTCGGCGTTGCGCGGGGCAGTGGCCGATCCGTCCTGCCTGGGG
GTGATCGTTGCCGGCGTTGAGGCTCAGGAGGCCGACGGCCTCGGTATATCCCTGGTGGCC
TCTGCGGCGCTGGTACAGGCCTTCGCCGGTGCGATTGCCAGCGTCGGAACACCGGCAAAG
CCGGTCTGGTTCGCCCTTCATGCCAGTGATGCTGCGTCGCCGGCCATGGCCGCTGTCCAG
GCCACCTGGCAGGGCGCCGCGCATATCTTCGCCCTGGAGCATCCTGCCTGGTGGGGCGGT
CTGGTGACTTTGCAGGGCAGCGACAGAAGAAGCTACGCCAGCCTCTGCCGGCTGTTGCAC
GGCCAACCTGGCCATGATCACTTTGCGATCAGCGGCGCCCGGGTCGAGGTGCAATACCTG
GTGGAGGATCAAGCCGACCCGCTACAGCGTCTGGAGCCGCCGGCGCTGAACGGAACCGTT
GTGCTGCATGCCGTCCCGGGATCTGACCTGGAGACTGTGCTGACGGCGCTCGGGCAGCGG
GGTGTGCAGCGTGTGCTGCTGCTCTGCGAGGCCCCCGGGCAACTGCACATGCCTGAGCGG
ATGCCCGAAGCGATGGCGATCAGCAGCCTCTCGGACCTGAGCCGGGAAAACCTGGCTGAC
ACCTTCGCGACGCTGCGAGCGCAAGACCGCATCGCCGGCTTTATCCACCTCGATCTTGAC
TGGCGCACGGTTGCGCTCAAGGAGCCAGAGTTTGTCGTGCGAATGCAGGAAGGCGTTCGG
CCGCTTGAGGTCTTGCAGCAGGTTCACCAGCTGATCGATGACCCTGAAGCGTTCTTCCTG
ATCCTGGGCAGCGTGTCTTCCCTGCTTGGCGGGGCCGGCTTCGCCCGCTCGGCGATTGCC
GATGCATATGCCTTGTGGGTGCATGCACAGCGCCGGCGCCAGGGGTTGAACTGCCAGCTG
CTGCACCTGACGCAGAGCGAACAGGAGCTTGAGCAGGACGCCGCAGCCCGCACGGCCATG
CAAGGCAGCGGCCTGCAGCCTTTGCAGCGCTCGCAGATAGTGCAGGCCATAGCCCGCGTG
CTGGGTGGCCAGGGCCAGTGCGGGCTGCTCAATGTCGACTGGCAACAACTCAAAGGGCTG
TACCTGAGCGTGCTGCCCTGGCCCTTGCTCGAACACCTGGGTGCAGCGGATAGCGCAGCG
GATCAGCGTCTGGCCGAGCTGATTGGCCTGCCACCGCTGCAGCAGCGCCGGGCCATGCAG
GCGCTGGTCTGCGAGGTAGTGGGGCAGGTGTTCGGCGTTGCCGATGGCCTGGAGCTCGAT
GTCAGGAAGGGCTTCTTCGACATGGGCATGTCCTCGGTCATGTCGCTGGACCTGCGCTCA
CGGCTGGGCCGGGCGTTGAGCATCGACCTGCCTTCGACCTTCGGCTTCGAATACACCTCC
ATCGAACAGGTCACGGACTACCTCATGGGCCAGCTCCTGGCGCCTGAAACCCGGGAGCCG
GTGGCGGCGCCCGAACCTGTGTCGCCAGCGTCGCGGCATCAGGACCTGCATGAACTGTCA
CGGGCCGAGCTGATTGGTGCTCTCGAAGACGAGCTGCGCGATATCGCCAATTACTAG
[1] KS10..383
[1] AT535..843
[1] malonyl-CoA725..729
[1] ACP941..1010
[2] KS1034..1398
[2] AT1699..2060
[2] malonyl-CoA1972..1976
[2] kr2198..2236
[2] ACP2339..2409
[1] KS28..1149
[1] AT1603..2529
[1] malonyl-CoA2173..2187
[1] ACP2821..3030
[2] KS3100..4194
[2] AT5095..6180
[2] malonyl-CoA5914..5928
[2] kr6592..6708
[2] ACP7015..7227

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001227 Acyl transferase domain (Domain)
 [724-838]  8.4e-70 G3DSA:3.40.366.10
G3DSA:3.40.366.10   no description
IPR006162 Phosphopantetheine attachment site (PTM)
 [2367-2382]  PS00012
PS00012   PHOSPHOPANTETHEINE
IPR009081 Acyl carrier protein-like (Domain)
 [947-1009]  4.3e-11 PF00550 [2343-2408]  1.9e-07 PF00550
PF00550   PP-binding
 [934-1049]  2.6e-21 SSF47336 [2332-2430]  2.7e-16 SSF47336
SSF47336   ACP-like
 [940-1040]  1.9e-14 G3DSA:1.10.1200.10 [2334-2410]  1e-09 G3DSA:1.10.1200.10
G3DSA:1.10.1200.10   no description
 [941-1010]  17.857 PS50075 [2339-2409]  17.104 PS50075
PS50075   ACP_DOMAIN
IPR014030 Beta-ketoacyl synthase, N-terminal (Domain)
 [10-261]  4.6e-87 PF00109 [1034-1273]  3.2e-80 PF00109
PF00109   ketoacyl-synt
IPR014031 Beta-ketoacyl synthase, C-terminal (Domain)
 [270-383]  2.3e-41 PF02801 [1282-1398]  2.4e-41 PF02801
PF02801   Ketoacyl-synt_C
IPR014043 Acyl transferase (Domain)
 [535-843]  8.8e-75 PF00698
PF00698   Acyl_transf_1
IPR016035 Acyl transferase/acyl hydrolase/lysophospholipase (Domain)
 [533-823]  3.9e-62 SSF52151
SSF52151   FabD/lysophospholipase-like
IPR016036 Malonyl-CoA ACP transacylase, ACP-binding (Domain)
 [660-724]  5e-11 SSF55048
SSF55048   Probable ACP-binding domain of malonyl-CoA ACP transacylase
IPR016038 Thiolase-like, subgroup (Domain)
 [12-273]  9.5e-90 G3DSA:3.40.47.10 [274-433]  4.7e-57 G3DSA:3.40.47.10 [1041-1284]  1e-86 G3DSA:3.40.47.10 [1286-1450]  1.8e-57 G3DSA:3.40.47.10
G3DSA:3.40.47.10   no description
IPR016039 Thiolase-like (Domain)
 [1-382]  2e-95 SSF53901 [1032-1395]  1.8e-85 SSF53901
SSF53901   Thiolase-like
IPR018201 Beta-ketoacyl synthase, active site (Active_site)
 [174-190]  PS00606 [1186-1202]  PS00606
PS00606   B_KETOACYL_SYNTHASE
IPR020801 Polyketide synthase, acyl transferase domain (Domain)
 [537-832]  3.9e-88 SM00827
SM00827   Acyl transferase domain in polyketide syntha
IPR020806 Polyketide synthase, phosphopantetheine-binding domain (Domain)
 [945-1013]  2e-16 SM00823 [2340-2412]  1.5e-17 SM00823
SM00823   Phosphopantetheine attachment site
IPR020841 Polyketide synthase, beta-ketoacyl synthase domain (Domain)
 [12-434]  4.1e-185 SM00825 [1035-1451]  2.7e-182 SM00825
SM00825   Beta-ketoacyl synthase
SignalP
 [1-37]  0.075 Signal
Eukaryota   
 [1-30]  0.222 Signal
Bacteria, Gram-positive   
 [1-22]  0.232 Signal
Bacteria, Gram-negative   
TMHMM No significant hit