close all open/close all

CDS information : Pyolu_00060


close this sectionLocation

Organism
StrainPf-5
Entry namePyoluteorin
Contig
Start / Stop / Direction12,267 / 17,591 / + [in whole cluster]
12,267 / 17,591 / + [in contig]
Location12267..17591 [in whole cluster]
12267..17591 [in contig]
TypeCDS
Length5,325 bp (1,774 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category1.1 PKS
Productpolyketide synthase
Product (GenBank)polyketide synthase type I
Gene
Gene (GenBank)pltC
EC number
Keyword
  • resorcinol ring moiety
Note
Note (GenBank)
  • module 3; PltC
Reference
ACC
PmId
[10094695] Characterization of the pyoluteorin biosynthetic gene cluster of Pseudomonas fluorescens Pf-5. (J Bacteriol. , 1999)
[9434161] Identification and sequence analysis of the genes encoding a polyketide synthase required for pyoluteorin biosynthesis in Pseudomonas fluorescens Pf-5. (Gene. , 1997)

close this sectionPKS/NRPS Module

3 malonyl-CoA
KS40..415
AT570..852
dh
KR1413..1591
ACP1690..1755

close this sectionSequence

selected fasta
>polyketide synthase [polyketide synthase type I]
MDNDVRDVSKEQLQESLAQAITTIRALKEKVAGKSSAPVEPIAVVGLGCRLPGSADTPKR
LWSLLKHATDAVGDMPSDRLYGTDYYHPDPQAPGKAYVMRGGFIEGVDQFDPGFFGISPK
EAEGMDPQQRLALEVAWEALENAAIAPDSLHGKKLGVFMGVSTNDYVRLRQQLGAVEDVN
AYQFYGETSFVAGRIAYTLGSRGPAVVLDTSCSSSLVALHQACNSLRSRESELALAGGVN
LILSPYGFILVSKLRAVAPDGRCKTFDAAADGYGRAEGCVILALKRLSDAVRDQDPVLAV
IEGSAVNNDGASSGITVPNIHAQEEVIRLALGQAGLQGSEVDYVEAHGTGTALGDPIELH
ALHAVLGKQRPVDAPLLVGSIKANMGHLEPVAGVTGLAKVLLCLQQEALVPQVHFNTPNP
RIEWDRLALKVVTESTPWPRQGKARHAGVSSFGVTGTNAHVLVGDAPLRERAQGRDNPWQ
LITLSAKGETPRRQIAGRYERFIADNSQLELKDLCYTANVGRAHFGHRFAAVADSREGLR
EQLAAYASRKVVGHVFEGRCQGAAAPLVMLFPGQGCQYRAMAQALYDSEPFFKAQIDECR
ALLQPLMDVDLLTLVLDAGAASDSYLQQTRYAQPAIFAVEYALARLWMHWGVAADALFGH
SFGEISAICVAGAVSLADALRMVEARGRLAQQLMTAGGAMYALGMSEAQLLELLKDRPGS
AIELAAVNSPQDVVVAGPQAEVQALAEAALASGCKVKKLAVSHAFHTAATEPMLEAFRQT
VAQITFSEPRLPVISSVTGRVHTLSSLSSPDYWCTHTRQAVRFCEGVNTLIAELGVKTFL
EVASDAVLTPLIGRHPLADGSLVLASLRRAGDPSRDLRLAAAQLYVGGHNLDWARLHEHD
GALRQALPGYAFQRQRYWFDNASGSPLQQVAAGAVGRLLGHSVNAPTPAFESTLDSALLQ
VVGGEIRDDLALLRPDRLLAALSDELAGHLQLDTYGVSLASITPALAFHVDDQLHLFTEL
KPLSGAAWEVNCSALSAAAKVAGADWQPVLSLTLEGLPAAVRGGLPDPGHAATQDAGFVY
HMQLPAEPDPHGNHLGQVLEYLGQAVPGDAPGSISGIRRWVASRSASPRAQSLVIATSQA
HPQQFDCALYDAHGQCVGSLEGLTLAAAPSEEALRGMLYQPDVLYSLDWLERPRQRAEVP
QQDRLFTLVSRSPETAAPLVEHLQRGGHRARVLCPQQLLDSARRVLAQDPSQALTDEGEA
LAADIIVLDGKDIEDAGSTTLQSLSSLQATLFHPLLEMVQALIELGPRGGRLWLVTQGAN
PVGLDRDQPLQVATGPLWGLGKTLALEHPEHWRGLIDLAPDDPHWARALAEEVSDSDGDD
KICLRPGKRYVQRLNHFSAAQLPAQAYAPCPQGSYLITGGMGGIGLAMAQWLLDKGAGAV
LITGRRPLEDVATGLERFGAAASRVSYVQADITSPQDMQRLFCGLEASGASLKGIFHAAG
ISIPQDLKDVDRDSFDQVMRPKVEGTWLLHELSLGLDLDFFVLCSSIASVWGSQHVASYA
AANQFLDSLAWQRRAMGLSALVIDWGLWAGGSHLFDEQVLNFLTSVGLKQIAPVQNVGLL
SRILASELPQMVVSGVDWNRFKPLLESRGPQPLLQYIRSQAPTARAGDSSNVEILQQLAG
ADEAAALALLDDYVWEQYAQLLGVKTEQVRAKLEDGGSLMDYGLDSLLVMDMVARCRRDL
KLEIKAREFLECPGLMWPDFLARSIKEQGCVAEA
selected fasta
>polyketide synthase [polyketide synthase type I]
ATGGATAACGATGTCCGCGATGTAAGCAAGGAACAGCTGCAAGAGAGTCTTGCTCAGGCA
ATCACTACCATCCGTGCGCTCAAGGAAAAGGTGGCCGGCAAGAGCTCGGCGCCTGTCGAA
CCGATCGCCGTAGTGGGCCTGGGGTGCCGGCTACCGGGCAGTGCCGACACACCGAAGCGG
CTGTGGAGCCTGCTGAAACATGCCACCGATGCGGTGGGCGACATGCCCAGCGACCGTCTG
TACGGCACCGACTATTACCATCCTGATCCCCAGGCACCCGGCAAGGCCTACGTCATGCGC
GGTGGCTTCATCGAGGGGGTGGATCAGTTCGACCCGGGCTTCTTCGGCATTTCGCCCAAG
GAAGCCGAAGGCATGGACCCCCAGCAGCGCCTGGCCCTGGAGGTTGCCTGGGAGGCCCTG
GAGAACGCCGCGATCGCCCCCGACAGCCTGCATGGCAAGAAGCTCGGCGTGTTCATGGGG
GTCAGTACCAATGATTACGTGCGCCTGCGCCAGCAGTTGGGCGCGGTCGAGGACGTCAAC
GCCTACCAGTTCTATGGCGAAACCAGCTTCGTGGCCGGGCGCATTGCCTACACCCTGGGC
TCCAGGGGCCCGGCGGTGGTGCTCGACACCTCCTGCTCCTCATCCCTGGTGGCCCTGCAC
CAGGCCTGCAACAGCCTGCGCAGCCGCGAGAGCGAGCTGGCGCTGGCCGGTGGGGTCAAC
CTGATCCTGTCGCCCTACGGTTTCATCCTGGTCAGCAAGCTGCGGGCCGTGGCCCCCGAT
GGCCGCTGCAAGACCTTCGACGCGGCGGCCGATGGCTACGGGCGCGCCGAAGGCTGCGTG
ATCCTTGCGCTCAAGCGGCTGAGCGATGCGGTACGCGACCAGGACCCGGTGCTGGCCGTG
ATCGAGGGTAGTGCGGTCAACAACGACGGCGCCAGCAGCGGCATCACCGTGCCCAACATC
CACGCCCAGGAAGAGGTGATCAGGCTGGCGCTCGGCCAGGCCGGGCTCCAGGGCAGCGAG
GTCGACTATGTCGAGGCCCATGGCACCGGCACCGCGCTGGGCGACCCGATCGAACTGCAC
GCCCTGCATGCGGTACTGGGCAAGCAGCGGCCCGTCGATGCACCGCTGCTGGTGGGCTCG
ATCAAGGCCAACATGGGGCATCTCGAACCGGTCGCCGGGGTGACCGGGCTGGCCAAGGTC
CTGCTGTGCCTGCAACAAGAGGCCCTGGTGCCCCAGGTGCACTTCAACACGCCCAACCCG
CGGATCGAATGGGATCGCCTGGCCCTGAAGGTGGTCACCGAATCCACGCCCTGGCCACGC
CAGGGCAAGGCGCGGCACGCCGGTGTCAGTTCGTTTGGTGTCACCGGCACCAACGCCCAT
GTGCTAGTGGGCGACGCGCCGCTGCGCGAACGTGCCCAGGGGCGCGACAACCCCTGGCAG
CTGATCACTCTGTCGGCCAAGGGCGAGACGCCCCGGCGCCAGATTGCCGGACGCTATGAA
CGTTTTATCGCCGACAACAGCCAGCTCGAACTCAAGGACCTGTGCTACACGGCGAACGTC
GGGCGGGCGCACTTTGGCCATCGTTTCGCGGCCGTGGCCGATAGCCGTGAGGGGCTGCGC
GAGCAACTGGCAGCCTATGCGTCACGCAAGGTCGTGGGGCATGTATTCGAAGGGCGCTGC
CAGGGAGCGGCGGCGCCGCTGGTGATGCTCTTTCCGGGGCAGGGCTGCCAGTACCGGGCA
ATGGCCCAGGCACTGTATGACAGCGAACCATTCTTCAAGGCGCAGATCGATGAATGCCGC
GCCCTGTTGCAGCCGCTGATGGACGTGGACCTGCTGACCCTGGTGCTGGACGCGGGTGCG
GCCAGTGACAGCTACCTGCAACAGACCCGCTATGCCCAGCCGGCGATATTCGCGGTCGAA
TATGCCCTGGCGCGGTTGTGGATGCATTGGGGGGTCGCTGCCGATGCGCTGTTCGGACAC
AGTTTCGGCGAGATCAGTGCAATCTGTGTAGCCGGGGCGGTATCCCTGGCTGACGCGCTG
CGTATGGTGGAGGCGCGTGGGCGCCTGGCCCAGCAACTGATGACGGCCGGCGGCGCGATG
TACGCACTGGGCATGAGCGAGGCGCAACTGCTGGAGCTGCTCAAGGACCGGCCCGGCAGC
GCGATCGAACTGGCGGCGGTCAACAGCCCGCAGGACGTGGTGGTGGCCGGGCCGCAAGCC
GAGGTCCAGGCGCTGGCCGAAGCGGCGCTCGCCAGCGGTTGCAAGGTCAAGAAGCTTGCG
GTTTCCCATGCCTTCCATACCGCAGCCACCGAGCCGATGCTTGAAGCGTTCCGCCAGACG
GTGGCGCAGATCACCTTCAGCGAGCCGCGCTTGCCGGTCATCAGCAGTGTCACTGGCCGG
GTGCATACGCTCTCCAGCCTGAGCTCGCCCGATTACTGGTGTACGCACACCCGCCAGGCC
GTGAGGTTCTGCGAAGGGGTCAACACCCTGATCGCAGAGCTGGGGGTGAAAACCTTCCTT
GAAGTGGCCTCCGATGCTGTGTTGACGCCGCTGATCGGCCGTCACCCCCTGGCGGACGGC
AGCCTGGTCCTGGCCAGCCTGCGCCGGGCCGGCGATCCGTCCAGGGACCTGCGCCTGGCC
GCCGCGCAGCTCTACGTGGGCGGCCATAACCTCGACTGGGCCCGGCTGCACGAGCATGAC
GGGGCCTTGCGCCAGGCCTTGCCCGGGTATGCGTTTCAGCGCCAGCGCTACTGGTTCGAC
AACGCCAGCGGCTCGCCCCTGCAACAGGTCGCTGCGGGAGCGGTCGGCCGGCTGCTGGGG
CATTCGGTCAATGCACCCACTCCGGCATTCGAGTCGACGCTCGATAGCGCGCTCCTGCAG
GTTGTGGGCGGCGAGATCCGCGATGACCTGGCGCTGCTGCGTCCTGACCGGTTGCTGGCA
GCCCTGAGCGATGAGCTGGCCGGCCACTTGCAGCTGGACACCTATGGGGTGAGCCTCGCC
AGCATCACCCCGGCCCTGGCGTTCCATGTCGATGACCAGTTGCATCTGTTCACCGAACTC
AAGCCGCTGTCCGGGGCGGCCTGGGAGGTCAACTGTTCGGCCCTGAGCGCAGCGGCCAAG
GTTGCCGGTGCCGATTGGCAGCCGGTCCTGTCGCTGACCCTGGAAGGCCTGCCGGCGGCT
GTCCGGGGCGGCCTGCCGGACCCGGGCCATGCCGCCACCCAGGACGCAGGCTTTGTCTAC
CACATGCAGTTGCCGGCAGAACCCGATCCGCACGGCAATCACCTTGGGCAGGTCCTCGAG
TACCTGGGGCAGGCGGTGCCGGGCGATGCGCCGGGCTCGATAAGCGGCATCCGCCGCTGG
GTCGCCAGCCGGTCCGCTTCGCCCCGGGCACAAAGCCTGGTGATTGCCACGAGCCAGGCA
CATCCGCAGCAGTTCGACTGCGCCTTGTACGATGCGCACGGCCAGTGTGTAGGCAGCCTG
GAAGGGCTGACCCTGGCTGCCGCCCCGAGTGAGGAGGCGCTGCGTGGCATGCTTTACCAG
CCCGACGTGCTCTACAGCCTGGATTGGCTCGAACGCCCTCGCCAGCGCGCCGAAGTGCCG
CAGCAGGACCGCTTGTTCACCCTGGTCAGCCGCTCGCCGGAGACCGCCGCTCCCCTGGTC
GAACACCTGCAGCGTGGCGGGCATCGTGCCCGGGTCCTGTGCCCGCAGCAGTTGCTCGAT
AGCGCGCGGAGGGTGCTGGCCCAGGACCCGAGCCAGGCATTGACCGATGAAGGCGAGGCC
TTGGCCGCCGATATCATCGTGCTCGATGGCAAAGACATCGAGGATGCCGGCTCGACCACG
CTGCAGAGCCTGTCGAGCCTGCAGGCGACACTGTTCCACCCGTTGCTGGAGATGGTCCAG
GCGCTCATCGAACTGGGCCCGCGCGGTGGCCGGTTGTGGCTGGTGACCCAAGGGGCAAAC
CCTGTTGGCCTGGATCGCGACCAGCCCCTGCAAGTGGCGACCGGGCCGTTGTGGGGGCTG
GGCAAGACGCTCGCCCTGGAGCACCCCGAACACTGGCGCGGGCTGATCGACCTGGCCCCC
GACGATCCTCACTGGGCAAGGGCGCTGGCCGAAGAAGTCAGCGACTCCGATGGCGACGAC
AAGATCTGCCTGCGCCCGGGCAAGCGTTATGTCCAGCGCCTGAACCATTTCAGCGCTGCG
CAGTTGCCAGCACAGGCCTATGCACCTTGCCCGCAGGGCAGTTACCTGATTACCGGCGGC
ATGGGTGGAATTGGCCTGGCCATGGCCCAGTGGCTTCTGGATAAAGGCGCGGGCGCTGTG
CTGATCACCGGCCGGCGGCCACTGGAGGATGTCGCCACGGGCCTGGAGCGCTTCGGCGCT
GCGGCATCGCGGGTGAGTTACGTCCAGGCCGACATCACCTCGCCCCAGGACATGCAGCGG
CTGTTCTGCGGTCTGGAGGCGTCGGGCGCGAGCCTGAAGGGCATCTTTCATGCCGCCGGG
ATTTCAATTCCGCAGGATCTCAAGGACGTCGACCGTGACAGTTTCGACCAGGTGATGCGG
CCCAAGGTCGAGGGCACCTGGTTGTTGCACGAACTGTCCCTGGGGCTGGACCTGGACTTC
TTTGTCCTGTGTTCGAGCATCGCCAGTGTCTGGGGTTCGCAGCATGTCGCCAGCTACGCA
GCCGCCAATCAGTTCCTCGACAGCCTGGCGTGGCAGCGTCGGGCCATGGGCCTGAGTGCC
CTGGTGATCGACTGGGGGCTGTGGGCCGGCGGCAGTCACCTGTTCGACGAGCAGGTGCTG
AATTTCCTCACCAGCGTTGGCTTGAAACAGATCGCCCCGGTACAGAACGTCGGCCTGCTG
TCGCGGATTCTGGCCAGCGAGCTGCCCCAGATGGTGGTGTCAGGGGTGGACTGGAATCGC
TTCAAGCCACTGCTCGAATCCCGCGGCCCGCAACCGCTGCTGCAGTACATCCGCAGCCAG
GCTCCGACCGCCAGGGCCGGCGACAGCAGCAACGTGGAGATCCTGCAGCAACTGGCGGGC
GCCGATGAAGCCGCTGCCCTGGCATTGCTGGATGACTACGTGTGGGAGCAGTACGCGCAG
TTGCTCGGGGTCAAGACCGAACAGGTGCGGGCCAAGCTCGAGGATGGCGGCAGCCTGATG
GACTACGGCCTGGACTCGCTGCTGGTGATGGACATGGTCGCCCGCTGCCGGCGCGATCTG
AAGCTGGAGATCAAGGCCCGCGAGTTTCTTGAGTGTCCGGGCCTGATGTGGCCGGACTTC
CTGGCCCGTTCGATAAAGGAACAGGGCTGCGTGGCCGAGGCCTGA
[3] KS40..415
[3] AT570..852
[3] malonyl-CoA763..767
[3] KR1413..1591
[3] ACP1690..1755
[3] KS118..1245
[3] AT1708..2556
[3] malonyl-CoA2287..2301
[3] KR4237..4773
[3] ACP5068..5265

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001227 Acyl transferase domain (Domain)
 [763-873]  2.6e-68 G3DSA:3.40.366.10
G3DSA:3.40.366.10   no description
IPR009081 Acyl carrier protein-like (Domain)
 [1690-1755]  11.105 PS50075
PS50075   ACP_DOMAIN
 [1683-1753]  4.8e-07 SSF47336
SSF47336   ACP-like
 [1701-1754]  2.1e-06 PF00550
PF00550   PP-binding
 [1680-1754]  8.5e-07 G3DSA:1.10.1200.10
G3DSA:1.10.1200.10   no description
IPR013968 Polyketide synthase, KR (Domain)
 [1413-1590]  6.2e-62 PF08659
PF08659   KR
IPR014030 Beta-ketoacyl synthase, N-terminal (Domain)
 [40-290]  6.6e-90 PF00109
PF00109   ketoacyl-synt
IPR014031 Beta-ketoacyl synthase, C-terminal (Domain)
 [298-415]  3.4e-40 PF02801
PF02801   Ketoacyl-synt_C
IPR014043 Acyl transferase (Domain)
 [570-852]  2.9e-59 PF00698
PF00698   Acyl_transf_1
IPR016035 Acyl transferase/acyl hydrolase/lysophospholipase (Domain)
 [566-874]  5.5e-61 SSF52151
SSF52151   FabD/lysophospholipase-like
IPR016036 Malonyl-CoA ACP transacylase, ACP-binding (Domain)
 [696-762]  1e-14 SSF55048
SSF55048   Probable ACP-binding domain of malonyl-CoA ACP transacylase
IPR016038 Thiolase-like, subgroup (Domain)
 [40-301]  1.1e-86 G3DSA:3.40.47.10 [302-468]  4.9e-58 G3DSA:3.40.47.10
G3DSA:3.40.47.10   no description
IPR016039 Thiolase-like (Domain)
 [40-409]  2.3e-93 SSF53901
SSF53901   Thiolase-like
IPR016040 NAD(P)-binding domain (Domain)
 [1414-1591]  2e-36 G3DSA:3.40.50.720
G3DSA:3.40.50.720   no description
IPR020801 Polyketide synthase, acyl transferase domain (Domain)
 [570-871]  2e-105 SM00827
SM00827   Acyl transferase domain in polyketide syntha
IPR020841 Polyketide synthase, beta-ketoacyl synthase domain (Domain)
 [42-468]  1.4e-190 SM00825
SM00825   Beta-ketoacyl synthase
IPR020842 Polyketide synthase/Fatty acid synthase, KR (Domain)
 [1413-1591]  1.2e-40 SM00822
SM00822   no description
SignalP No significant hit
TMHMM No significant hit