close all open/close all

CDS information : Pyolu_00070


close this sectionLocation

Organism
StrainPf-5
Entry namePyoluteorin
Contig
Start / Stop / Direction17,642 / 19,276 / + [in whole cluster]
17,642 / 19,276 / + [in contig]
Location17642..19276 [in whole cluster]
17642..19276 [in contig]
TypeCDS
Length1,635 bp (544 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.3 uncharacterized protein (biosynthesis involved)
Producthypothetical protein
Product (GenBank)PltD
Gene
Gene (GenBank)pltD
EC number
Keyword
Note
Note (GenBank)
  • similar to halogenases but no obvious NAD(P)H binding region
Reference
ACC
PmId
[10094695] Characterization of the pyoluteorin biosynthetic gene cluster of Pseudomonas fluorescens Pf-5. (J Bacteriol. , 1999)

close this sectionSequence

selected fasta
>hypothetical protein [PltD]
MNDVQSGKAPEHYDILLAGNSISVIMLAACLARNKVRVGLLRNRQMPPDLTGEATIPYTS
MIFELIADRYGVPEIKNIARTRDIQQKVMPSSGVKKNLGFIYHQRSRAVDLGQALQFNVP
SEHGENHLFRPDIDAYLLAAAIGYGAQLVEIDNSPEVLVEDSGVKVATALGRWVTADFMV
DGSQGGQVLARQAGLVSQASTQKTRTLEFSTHMLGVVPFDECVQGDFPGQWHGGTLHHVF
DGGWVGVIPFNNHQHSRNPLVSVLVSLREDLCPSMDGDQVLAGLIELYPGLGRHLSGARR
VREWVLRQPPRQVYRTALERRCLMFDEGAASNDLLFSRKLSNAAELVLALAHRLIKAAHS
GDYRSPALNDFVLTQDSIISLSDRIALAAYVSFRDPELWNAFARVWLLQSIAATITARKI
NDAFAKDLDPRVFDEIDQLAEDGFWMPLYRGYKDILNTTLGLCDDVKSAKVSAAHAASSI
FAELANASFVPPIFDFANPHARVYQLTTLRKLKALWWGLMQVPSEVGRLIFYRSFRKPSL
RKES
selected fasta
>hypothetical protein [PltD]
ATGAACGATGTGCAGTCTGGCAAGGCGCCAGAGCATTACGACATTCTCTTGGCGGGCAAC
AGCATCAGCGTGATCATGCTCGCCGCCTGCCTGGCCCGGAACAAGGTCCGGGTCGGTTTG
TTGCGCAACCGGCAGATGCCCCCCGACCTTACCGGTGAGGCGACGATTCCCTATACCTCG
ATGATTTTCGAGCTGATTGCCGACCGCTATGGCGTGCCGGAAATAAAGAATATCGCCCGC
ACCCGGGATATCCAGCAGAAGGTGATGCCGTCTTCCGGGGTCAAGAAGAACCTCGGGTTC
ATCTATCACCAGCGCAGCCGGGCGGTGGACCTGGGCCAGGCGCTGCAATTCAACGTGCCC
TCCGAGCATGGCGAGAACCATCTGTTCAGGCCCGATATCGATGCCTATCTGCTGGCGGCG
GCCATCGGTTATGGCGCGCAGCTGGTGGAGATCGATAACAGCCCAGAGGTGCTGGTCGAG
GACAGCGGGGTCAAGGTAGCTACGGCACTGGGGCGCTGGGTCACTGCCGATTTCATGGTT
GATGGCAGCCAGGGCGGCCAGGTGCTGGCGCGGCAGGCTGGCCTGGTCAGCCAGGCTTCG
ACGCAGAAGACCCGGACCCTGGAATTCTCCACTCATATGCTCGGGGTGGTGCCGTTCGAT
GAGTGCGTGCAGGGCGATTTTCCCGGCCAGTGGCATGGCGGCACTCTGCATCACGTGTTC
GATGGGGGCTGGGTGGGGGTCATCCCGTTCAACAACCATCAGCACTCGCGCAACCCTTTG
GTCAGCGTGCTGGTTTCACTGCGTGAGGACCTCTGCCCGAGCATGGACGGCGACCAGGTC
CTGGCCGGCCTGATCGAGCTGTACCCCGGCCTGGGGCGGCACCTGTCCGGCGCCCGGCGG
GTGCGCGAGTGGGTGCTGCGCCAGCCGCCCCGGCAGGTCTATCGCACGGCGCTCGAACGC
CGCTGCCTGATGTTCGACGAGGGCGCCGCGAGCAACGATCTGTTGTTCTCGCGCAAGCTG
TCCAATGCTGCGGAACTGGTTCTGGCCCTGGCGCACCGGCTGATCAAGGCGGCGCACAGC
GGTGACTACCGCAGCCCGGCCCTGAATGATTTTGTCCTGACCCAGGACAGCATCATCAGC
TTGAGTGACCGGATCGCCTTAGCGGCTTATGTGTCGTTTCGCGACCCCGAGTTGTGGAAT
GCCTTCGCCCGTGTCTGGCTGCTGCAGTCGATTGCCGCCACCATCACCGCGCGCAAGATC
AACGATGCCTTTGCCAAGGACCTGGACCCGCGAGTGTTCGATGAAATCGACCAGCTCGCA
GAGGACGGTTTCTGGATGCCTCTGTATCGGGGGTACAAGGATATTCTCAACACTACGCTG
GGCCTTTGTGATGACGTCAAAAGCGCCAAGGTCTCTGCTGCGCACGCGGCGAGCAGCATC
TTTGCGGAGCTTGCCAACGCCAGTTTTGTTCCGCCTATTTTTGATTTTGCTAATCCTCAC
GCTCGTGTCTATCAACTGACCACCTTGAGAAAGCTCAAGGCGCTCTGGTGGGGCCTGATG
CAAGTGCCCTCAGAGGTCGGACGGCTGATTTTCTATCGATCCTTCAGAAAACCTTCCCTG
CGCAAGGAGAGTTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
No significant hit
SignalP No significant hit
TMHMM No significant hit