close all open/close all

CDS information : Pyolu_00080


close this sectionLocation

Organism
StrainPf-5
Entry namePyoluteorin
Contig
Start / Stop / Direction19,278 / 20,420 / + [in whole cluster]
19,278 / 20,420 / + [in contig]
Location19278..20420 [in whole cluster]
19278..20420 [in contig]
TypeCDS
Length1,143 bp (380 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.2 modification addition of starter unit
ProductL-prolyl-PCP dehydrogenase
Product (GenBank)putative acyl-CoA dehydrogenase
Gene
Gene (GenBank)pltE
EC number1.3.99.-
Keyword
  • pyrrole ring moiety
Note
Note (GenBank)
  • PltE
Reference
ACC
PmId
[10094695] Characterization of the pyoluteorin biosynthetic gene cluster of Pseudomonas fluorescens Pf-5. (J Bacteriol. , 1999)
[11880032] Conversion of L-proline to pyrrolyl-2-carboxyl-S-PCP during undecylprodigiosin and pyoluteorin biosynthesis. (Chem Biol. , 2002)

close this sectionSequence

selected fasta
>L-prolyl-PCP dehydrogenase [putative acyl-CoA dehydrogenase]
MDFNYDDTQKKHAAMIAQVCAEQLAACGNEHSRYFTARQWAICGEAGLLGLSIPREYGGQ
GLGALSTAIAMHAFGLGCTDMGLVFAAAAHQFACAMPIVEFATAETKRDVLPKLASGEFI
GSNAITEPEAGSDSSNLKSRAWPQADGSYRLDGHKSFAGNAPIADIFVTYATTQPEYGAL
GVSGFIVHRSSAGLRVSEPLDKVCLRSCPAGEVFFDDCRVPEVNRLGEEGQGRQVFQSSM
GWERACLFAAFLGMMERQLEQTIEHARTRRQFGKPIGDNQAVSHRIAQMKLRLESARLLL
FRACWGMDQGDPGQLNIALSKLAISEGALASSIDAVRIFGGRGCLESFGIEAMLRDSIGT
TIFSGTSDMQHEIIARELKL
selected fasta
>L-prolyl-PCP dehydrogenase [putative acyl-CoA dehydrogenase]
ATGGACTTCAACTACGACGATACCCAGAAAAAACATGCGGCCATGATCGCCCAGGTGTGT
GCCGAGCAATTGGCGGCCTGTGGCAATGAACACTCGCGGTATTTCACTGCCCGGCAATGG
GCGATCTGCGGCGAGGCCGGATTGCTGGGGCTGTCGATTCCCCGGGAATACGGTGGCCAG
GGCCTGGGTGCACTGTCGACGGCCATTGCCATGCACGCCTTTGGCCTGGGTTGCACAGAC
ATGGGCCTGGTGTTCGCGGCGGCGGCCCACCAGTTTGCCTGTGCGATGCCGATCGTCGAG
TTCGCAACAGCGGAAACCAAACGCGATGTGTTGCCCAAACTCGCCAGCGGTGAATTCATC
GGCTCCAACGCGATCACCGAACCCGAGGCCGGCTCCGACTCCAGCAATTTGAAGAGCCGT
GCCTGGCCCCAGGCCGATGGCAGTTATCGCCTTGACGGCCACAAGAGCTTTGCCGGCAAT
GCGCCGATTGCCGACATCTTCGTGACCTATGCCACCACCCAGCCCGAGTACGGTGCCCTG
GGGGTCAGCGGTTTTATCGTCCACCGCAGCAGTGCGGGGCTCAGGGTCAGTGAGCCCCTG
GACAAGGTATGCCTGAGAAGCTGCCCCGCGGGTGAAGTGTTCTTTGACGATTGCAGGGTT
CCTGAGGTCAACCGCCTGGGTGAGGAGGGGCAGGGCCGGCAGGTGTTCCAGAGCTCCATG
GGCTGGGAGCGTGCCTGCCTGTTCGCAGCGTTCCTGGGGATGATGGAGCGGCAACTGGAA
CAGACCATCGAGCATGCGCGCACCCGGCGCCAGTTTGGCAAGCCGATTGGCGACAACCAG
GCGGTTTCGCACCGTATCGCGCAAATGAAGCTGCGCCTGGAGTCGGCGCGGTTGCTGCTG
TTCCGGGCGTGCTGGGGCATGGACCAGGGCGATCCGGGGCAGCTCAACATTGCCCTGTCG
AAACTGGCCATCAGTGAAGGGGCGCTGGCATCTAGCATCGATGCGGTGAGGATTTTCGGC
GGCCGGGGCTGCCTGGAGTCTTTCGGGATCGAGGCGATGCTGCGCGACTCCATCGGCACT
ACGATCTTTTCCGGCACCAGCGACATGCAGCACGAGATCATTGCCCGGGAGCTGAAGCTA
TGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR006090 Acyl-CoA oxidase/dehydrogenase, type 1 (Domain)
 [230-378]  4.2e-38 PF00441
PF00441   Acyl-CoA_dh_1
IPR006091 Acyl-CoA oxidase/dehydrogenase, central domain (Domain)
 [124-173]  2.6e-13 PF02770
PF02770   Acyl-CoA_dh_M
 [123-219]  2.8e-27 G3DSA:2.40.110.10
G3DSA:2.40.110.10   no description
IPR006092 Acyl-CoA dehydrogenase, N-terminal (Domain)
 [7-118]  4e-20 PF02771
PF02771   Acyl-CoA_dh_N
IPR009075 Acyl-CoA dehydrogenase/oxidase C-terminal (Domain)
 [220-378]  3.5e-50 G3DSA:1.20.140.10
G3DSA:1.20.140.10   no description
 [228-378]  3.4e-42 SSF47203
SSF47203   Acyl-CoA dehydrogenase C-terminal domain-like
IPR009100 Acyl-CoA dehydrogenase/oxidase (Domain)
 [1-230]  1.5e-61 SSF56645
SSF56645   Acyl-CoA dehydrogenase NM domain-like
IPR013786 Acyl-CoA dehydrogenase/oxidase, N-terminal (Domain)
 [1-119]  7.3e-23 G3DSA:1.10.540.10
G3DSA:1.10.540.10   no description
SignalP No significant hit
TMHMM No significant hit