close all open/close all

CDS information : Pyolu_00090


close this sectionLocation

Organism
StrainPf-5
Entry namePyoluteorin
Contig
Start / Stop / Direction20,417 / 21,913 / + [in whole cluster]
20,417 / 21,913 / + [in contig]
Location20417..21913 [in whole cluster]
20417..21913 [in contig]
TypeCDS
Length1,497 bp (498 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category1.4 Other
ProductL-proline--PCP ligase
L-prolyl-PCP synthetase
Product (GenBank)putative acyl-CoA synthetase
Gene
Gene (GenBank)pltF
EC number
Keyword
  • pyrrole ring moiety
Note
Note (GenBank)
  • PltF
Reference
ACC
PmId
[10094695] Characterization of the pyoluteorin biosynthetic gene cluster of Pseudomonas fluorescens Pf-5. (J Bacteriol. , 1999)
[11880032] Conversion of L-proline to pyrrolyl-2-carboxyl-S-PCP during undecylprodigiosin and pyoluteorin biosynthesis. (Chem Biol. , 2002)

close this sectionPKS/NRPS Module

0
A29..428

close this sectionSequence

selected fasta
>L-proline--PCP ligase [putative acyl-CoA synthetase]
MKLLHERMMHSLARYPRQTAVVDEQDALSYEALELRIREFVAMLCALGVGQGQRILLWAH
KSVDLVAVMQAALRLGVVYVPVDPLSPVSRLEKIAGDSQAVLVLCTAARLEELAGSALAQ
VRSVVLDDPASAGYWRNIDTGSSVVPTLAIQPDDLAYILYTSGSTGVPKGVALSHGNALA
FVDWACERYCFQPGERFANHAPLHFDLSVLDIYCALNVGATVCLVPESIAFSPRLLTDFI
RQHEISIWYSVPSVLMMMMQDGDLLSDIQDTLRVLLFAGEPFPVKHLRDLRAAYADVRLA
NLFGPTETNVCTAFEVGAIDPERVLPVPIGTAASGNQVWAQKPDGSRCAVGEEGELVVQG
PTVMLGYFAKPAQEGPYKTGDMVRQRPDGNYEYLGRRDDMLKVRGNRIERGEVEAALLAH
PQVSEAAVLVVGEGMNAQLWGVLVAHTRDALSLIDLKRHCAQRLPRYMIIDKVLCLDALP
RNANGKVDRFALARQVEG
selected fasta
>L-proline--PCP ligase [putative acyl-CoA synthetase]
ATGAAGCTGCTCCATGAACGGATGATGCACAGCCTTGCCCGCTACCCGCGGCAGACGGCG
GTGGTGGATGAGCAGGATGCCTTGAGCTACGAGGCGCTGGAGCTCAGGATCCGGGAATTC
GTGGCAATGCTCTGTGCCCTGGGGGTCGGCCAGGGGCAGCGGATCCTGCTCTGGGCGCAC
AAGTCGGTGGACCTGGTGGCGGTCATGCAGGCGGCCCTGCGGCTGGGGGTGGTGTATGTG
CCGGTGGACCCTCTGAGCCCGGTGTCGCGCCTGGAAAAGATCGCCGGGGATTCCCAGGCC
GTGCTGGTCCTCTGCACCGCGGCACGCCTGGAAGAACTCGCCGGCTCCGCGCTTGCCCAG
GTGCGCAGCGTGGTCCTGGACGACCCGGCCAGCGCCGGCTACTGGCGCAACATCGATACC
GGCTCCAGCGTAGTGCCGACGCTGGCCATCCAGCCGGACGATCTGGCCTACATCCTCTAC
ACCTCCGGGTCCACCGGCGTGCCCAAAGGGGTTGCGCTCAGCCACGGCAATGCCCTGGCC
TTCGTCGACTGGGCGTGCGAGCGCTATTGCTTCCAGCCTGGCGAGCGTTTCGCCAACCAT
GCCCCCCTGCATTTCGACCTGTCGGTCCTGGACATCTACTGCGCGCTCAATGTGGGCGCG
ACGGTGTGCCTGGTTCCCGAGTCGATCGCGTTCTCGCCGCGGCTGCTGACCGACTTCATC
CGCCAGCACGAAATCAGCATCTGGTACTCGGTGCCCTCGGTACTCATGATGATGATGCAA
GACGGCGACTTGCTCAGCGATATCCAGGACACCCTGCGGGTACTGTTGTTCGCCGGCGAG
CCTTTTCCGGTCAAGCACCTGCGTGACCTGCGCGCGGCCTATGCCGATGTGCGTCTGGCC
AATCTCTTCGGCCCCACGGAAACCAATGTGTGCACCGCATTCGAGGTCGGCGCCATCGAT
CCCGAGCGCGTGCTCCCGGTGCCCATCGGCACGGCCGCCTCCGGCAACCAGGTGTGGGCG
CAAAAGCCTGATGGCAGCCGCTGCGCAGTGGGTGAAGAAGGTGAGCTGGTGGTGCAGGGG
CCTACGGTCATGCTGGGCTATTTCGCCAAGCCGGCTCAGGAGGGGCCCTACAAGACCGGC
GATATGGTCAGGCAGCGGCCTGACGGCAACTACGAATACCTGGGGCGTCGTGACGACATG
CTCAAGGTGCGTGGCAACCGGATCGAGCGCGGGGAAGTCGAAGCCGCGCTGCTGGCCCAT
CCCCAGGTCAGCGAGGCCGCCGTGCTGGTGGTCGGGGAGGGGATGAACGCGCAGTTGTGG
GGCGTGCTGGTCGCTCACACCCGGGACGCTCTTTCGCTGATCGACCTCAAGCGCCACTGC
GCCCAGCGCCTGCCTCGCTACATGATCATCGACAAGGTGCTGTGCCTGGACGCACTGCCA
CGCAACGCCAATGGCAAGGTCGATCGCTTCGCCCTGGCCAGGCAGGTGGAGGGCTGA
[0] A29..428
[0] A85..1284

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000873 AMP-dependent synthetase/ligase (Domain)
 [29-428]  1.5e-103 PF00501
PF00501   AMP-binding
IPR010071 Amino acid adenylation domain (Domain)
 [29-428]  5.8e-100 TIGR01733
TIGR01733   AA-adenyl-dom: amino acid adenylation domain
IPR020459 AMP-binding (Domain)
 [153-164]  3.4e-05 PR00154 [165-173]  3.4e-05 PR00154
PR00154   AMPBINDING
IPR020845 AMP-binding, conserved site (Conserved_site)
 [158-169]  PS00455
PS00455   AMP_BINDING
SignalP No significant hit
TMHMM No significant hit