close all open/close all

CDS information : Pyolu_00100


close this sectionLocation

Organism
StrainPf-5
Entry namePyoluteorin
Contig
Start / Stop / Direction21,917 / 22,699 / + [in whole cluster]
21,917 / 22,699 / + [in contig]
Location21917..22699 [in whole cluster]
21917..22699 [in contig]
TypeCDS
Length783 bp (260 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category1.4 Other
Productputative thioesterase
Product (GenBank)putative thioesterase
Gene
Gene (GenBank)pltG
EC number
Keyword
Note
Note (GenBank)
  • PltG
Reference
ACC
PmId
[10094695] Characterization of the pyoluteorin biosynthetic gene cluster of Pseudomonas fluorescens Pf-5. (J Bacteriol. , 1999)
Related Reference
ACC
Q6W5Q5
NITE
FR008_00110
PmId
[18836004] Selective removal of aberrant extender units by a type II thioesterase for efficient FR-008/candicidin biosynthesis in Streptomyces sp. strain FR-008. (Appl Environ Microbiol. , 2008)

close this sectionSequence

selected fasta
>putative thioesterase [putative thioesterase]
MGTPSRVAKDAWFPYASRPRGKMRLFTFPYAGSGASVFHRWFLPLYDQVDLYALQLPGRE
GRSQEACYSDMQAAANDVADCLEQFGDDIPCCFFGHSMGALLAFAVAGVLQERRLPMPQQ
LMLSGMVAPHVRQRVAPLHQLPAEQAIAALQAMGGVPAVVLAEEDLMQMYLPIIQADIQM
VYSYAGAQPQPLDTRMICLSGAQDLIAPPAQMQQWRRYTLGGFEQFVFAGGHFFLDAQVM
SRVKTVLGSALHNQPGSLAV
selected fasta
>putative thioesterase [putative thioesterase]
ATGGGAACTCCATCACGCGTGGCCAAGGACGCCTGGTTTCCCTATGCCAGCCGGCCTCGG
GGCAAGATGCGCCTGTTCACCTTTCCCTATGCCGGGAGTGGGGCCTCGGTCTTTCATCGC
TGGTTCCTGCCCCTGTACGACCAGGTCGACCTGTATGCCTTGCAGTTGCCGGGCCGCGAG
GGTCGCAGCCAGGAGGCCTGCTACAGCGACATGCAGGCGGCGGCCAATGACGTGGCCGAC
TGCCTGGAGCAGTTTGGCGATGACATCCCCTGCTGTTTCTTCGGCCACAGCATGGGCGCC
TTGCTGGCCTTTGCGGTCGCCGGTGTGCTGCAGGAGCGGCGGTTGCCGATGCCGCAGCAA
CTGATGCTCTCGGGCATGGTTGCGCCCCATGTGCGGCAACGGGTAGCACCGCTGCACCAG
CTGCCGGCAGAGCAGGCCATCGCCGCGCTGCAGGCCATGGGGGGCGTGCCGGCGGTGGTG
CTGGCCGAGGAGGACCTGATGCAGATGTACCTGCCCATCATTCAGGCCGACATACAGATG
GTCTACTCCTACGCCGGTGCCCAGCCGCAGCCGCTGGACACCCGCATGATCTGCCTGAGC
GGCGCCCAGGACCTGATTGCGCCGCCTGCGCAGATGCAGCAGTGGCGGCGCTACACCCTG
GGCGGCTTCGAGCAGTTCGTGTTTGCCGGTGGCCATTTCTTTCTCGACGCCCAGGTCATG
TCGCGGGTCAAAACAGTGCTGGGCAGCGCCCTGCACAATCAGCCTGGCAGTCTGGCGGTG
TGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001031 Thioesterase (Domain)
 [24-239]  8.1e-37 PF00975
PF00975   Thioesterase
IPR020802 Polyketide synthase, thioesterase domain (Domain)
 [26-247]  0.0057 SM00824
SM00824   Thioesterase
SignalP No significant hit
TMHMM No significant hit