close all open/close all

CDS information : Pyolu_00110


close this sectionLocation

Organism
StrainPf-5
Entry namePyoluteorin
Contig
Start / Stop / Direction23,376 / 22,705 / - [in whole cluster]
23,376 / 22,705 / - [in contig]
Locationcomplement(22705..23376) [in whole cluster]
complement(22705..23376) [in contig]
TypeCDS
Length672 bp (223 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category4.1 transcriptional regulator
Productputative TetR family transcriptional regulator
Product (GenBank)PltZ
Gene
Gene (GenBank)pltZ
EC number
Keyword
Note
Note (GenBank)
  • putative TetR type transcriptional regulator; similar to pltZ from Pseudomonas sp. M18
Reference
ACC
PmId
[16269724] Reciprocal regulation of pyoluteorin production with membrane transporter gene expression in Pseudomonas fluorescens Pf-5. (Appl Environ Microbiol. , 2005)
Related Reference
ACC
Q6TLJ3
PmId
[15033239] Identification and characterization of pltZ, a gene involved in the repression of pyoluteorin biosynthesis in Pseudomonas sp. M18. (FEMS Microbiol Lett. , 2004)

close this sectionSequence

selected fasta
>putative TetR family transcriptional regulator [PltZ]
MKQPPAQTTRNIMNTRRRTSRSDGEHTKIRILEVAARLFAQHGYANTASKLICEEAGADL
AAINYHFGSREALYKAVLIEGHKQLVSFEALSQLAQSEEPALIKLDSFIDAIVTRVLDEQ
SWQSKVCAREILAPTVHFTSLVQEEVMPKFRLLEALISEITGFPIGDPALARCTISIIAP
CLMLAVIDRQQPSPLQAVLQHDANALKAHFKLFARSGLAAIAQ
selected fasta
>putative TetR family transcriptional regulator [PltZ]
ATGAAGCAACCCCCCGCTCAGACCACGAGGAACATCATGAACACGCGACGCAGAACCAGC
AGAAGCGACGGCGAACACACTAAAATCCGCATTCTCGAAGTGGCTGCCCGCCTGTTTGCC
CAGCATGGCTATGCCAACACCGCGAGCAAGCTCATCTGTGAAGAAGCCGGCGCCGACCTC
GCCGCCATCAACTACCACTTCGGTAGCCGGGAAGCCCTGTACAAGGCGGTGCTGATCGAG
GGACACAAGCAGCTGGTGAGCTTCGAAGCCCTGTCGCAGCTGGCGCAAAGCGAAGAGCCG
GCGCTGATCAAGCTCGATAGCTTCATCGATGCCATCGTCACCCGGGTGCTCGATGAGCAG
AGCTGGCAAAGCAAAGTCTGTGCACGGGAAATACTGGCGCCCACTGTCCATTTCACCAGC
CTTGTGCAAGAAGAAGTGATGCCCAAATTCCGTCTGCTGGAAGCGCTCATCAGCGAGATC
ACCGGCTTTCCGATCGGTGACCCGGCGCTGGCGCGTTGCACCATCAGCATCATCGCGCCC
TGCCTGATGCTGGCGGTGATAGATCGCCAGCAGCCCAGCCCGCTGCAAGCCGTCCTGCAA
CACGACGCCAACGCCCTGAAAGCCCACTTCAAGCTGTTCGCCAGGTCCGGCCTCGCGGCC
ATTGCCCAATAG

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001647 DNA-binding HTH domain, TetR-type (Domain)
 [31-77]  7.5e-13 PF00440
PF00440   TetR_N
 [31-44]  4e-08 PR00455 [52-75]  4e-08 PR00455
PR00455   HTHTETR
 [25-85]  18.273 PS50977
PS50977   HTH_TETR_2
IPR009057 Homeodomain-like (Domain)
 [15-103]  2.2e-15 SSF46689
SSF46689   Homeodomain-like
IPR011075 Tetracycline transcriptional regulator, TetR-related, C-terminal (Domain)
 [95-211]  9.6e-31 SSF48498
SSF48498   Tetracyclin repressor-like, C-terminal domain
IPR015292 Transcription regulator YbiH, C-terminal (Domain)
 [104-218]  1.1e-27 PF09209
PF09209   DUF1956
IPR015893 Tetracycline transcriptional regulator, TetR-like, C-terminal (Domain)
 [14-204]  3.5e-28 G3DSA:1.10.357.10
G3DSA:1.10.357.10   no description
SignalP No significant hit
TMHMM No significant hit