close all open/close all

CDS information : Pyolu_00120


close this sectionLocation

Organism
StrainPf-5
Entry namePyoluteorin
Contig
Start / Stop / Direction23,452 / 24,465 / + [in whole cluster]
23,452 / 24,465 / + [in contig]
Location23452..24465 [in whole cluster]
23452..24465 [in contig]
TypeCDS
Length1,014 bp (337 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category4.3 transport
Productputative membrane fusion protein
Product (GenBank)PltI
Gene
Gene (GenBank)pltI
EC number
Keyword
  • type I secretion system
Note
Note (GenBank)
  • putative membrane fusion proteins; similar to HlyD
Reference
ACC
PmId
[16269724] Reciprocal regulation of pyoluteorin production with membrane transporter gene expression in Pseudomonas fluorescens Pf-5. (Appl Environ Microbiol. , 2005)
Related Reference
ACC
Q4VWD0
PmId
[16581203] Identification and characterization of a putative ABC transporter PltHIJKN required for pyoluteorin production in Pseudomonas sp. M18. (Gene. , 2006)

close this sectionSequence

selected fasta
>putative membrane fusion protein [PltI]
MKKQLIVGVAVLLVATAGVSWFLLRPEKQNDHLKLHGNVDIRQVSLAFDGSERIAALYAE
EGDLVQPGQVLAELDTRTLRLEINRSKARIGAQEQALLRLKNGTRPQEVEQSKARFDAAQ
AQMQLAQLHMQRLRRIADDTQGKGVSQQRLDQAAARLQVAKAQSQEQRESWTLAKIGPRN
EDIAQATADLQASRADLDLLEHYLARAQLKAPTQARIRTRLLEPGDMASPQRPVFALALT
DPKWVRAYVNERQLGHIRADQMARVYTDSFPDQAIDGKVGYISSVAEFTPKSVETEDLRT
SLVYEIRVLVKDPDDRLRLGMPATVYLDQAPVAGATP
selected fasta
>putative membrane fusion protein [PltI]
ATGAAGAAGCAGTTGATTGTAGGGGTTGCCGTACTGCTGGTGGCCACAGCGGGTGTTTCC
TGGTTTCTCCTTCGCCCCGAGAAGCAGAACGACCACCTCAAGCTCCATGGCAACGTCGAC
ATTCGCCAGGTGTCACTGGCGTTCGACGGCAGTGAGCGAATCGCCGCGCTGTATGCCGAA
GAGGGCGACCTGGTGCAGCCAGGCCAGGTCCTGGCGGAACTCGACACACGCACACTGCGC
CTGGAAATAAATCGCTCCAAGGCCAGGATCGGCGCCCAGGAACAGGCGCTGCTGCGCTTG
AAAAATGGCACACGGCCTCAAGAGGTCGAGCAGTCCAAGGCACGTTTTGATGCCGCCCAG
GCGCAAATGCAGCTGGCTCAACTGCACATGCAGCGCCTGCGCAGGATCGCCGACGACACC
CAGGGCAAGGGCGTCAGCCAGCAACGCCTGGACCAGGCAGCCGCCCGCTTGCAAGTGGCC
AAGGCCCAGTCGCAGGAGCAGCGCGAATCCTGGACCCTGGCCAAGATCGGCCCACGCAAT
GAAGACATCGCCCAGGCCACGGCCGACCTGCAAGCCTCCAGGGCCGACCTGGACCTGCTG
GAACATTACCTGGCGCGCGCTCAGCTCAAGGCGCCGACCCAGGCCCGGATCCGCACGCGC
CTGCTGGAGCCGGGGGATATGGCCTCGCCCCAGCGCCCGGTGTTTGCCCTGGCCCTGACC
GACCCCAAGTGGGTACGGGCCTATGTCAACGAACGCCAGTTGGGCCACATACGTGCGGAC
CAGATGGCGCGGGTCTACACCGACAGCTTTCCTGACCAGGCCATCGACGGCAAAGTCGGC
TACATCTCCTCGGTTGCCGAATTCACCCCCAAGTCGGTGGAAACGGAAGACCTGCGCACC
AGCCTGGTCTACGAGATCCGGGTGCTGGTCAAGGACCCTGACGATCGCCTGCGGCTCGGT
ATGCCGGCGACCGTCTACCTTGACCAGGCACCGGTGGCCGGGGCCACGCCATGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR006143 RND efflux pump, membrane fusion protein (Family)
 [53-273]  6.7e-14 PF00529
PF00529   HlyD
SignalP
 [1-18]  0.942 Signal
Eukaryota   
 [1-17]  0.926 Signal
Bacteria, Gram-negative   
TMHMM
 [5-24]  Transmembrane (i-o)
Transmembrane 1