close all open/close all

CDS information : Pyolu_00130


close this sectionLocation

Organism
StrainPf-5
Entry namePyoluteorin
Contig
Start / Stop / Direction24,462 / 26,231 / + [in whole cluster]
24,462 / 26,231 / + [in contig]
Location24462..26231 [in whole cluster]
24462..26231 [in contig]
TypeCDS
Length1,770 bp (589 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category4.3 transport
Productputative ABC transporter ATP-binding protein
Product (GenBank)PltJ
GenepltJ
Gene (GenBank)PltJ
EC number
Keyword
  • type I secretion system
Note
Note (GenBank)
  • putative ATP-binding cassette of ABC transporter
Reference
ACC
PmId
[16269724] Reciprocal regulation of pyoluteorin production with membrane transporter gene expression in Pseudomonas fluorescens Pf-5. (Appl Environ Microbiol. , 2005)
Related Reference
ACC
Q4VWC9
PmId
[16581203] Identification and characterization of a putative ABC transporter PltHIJKN required for pyoluteorin production in Pseudomonas sp. M18. (Gene. , 2006)

close this sectionSequence

selected fasta
>putative ABC transporter ATP-binding protein [PltJ]
MSAPAVTVQAVELVKRFRSGTREQLALEQVSLEVPSGKLSALVGPDGAGKTTLLRMIAGL
LKADEGLLKVLGLDVAADPQQVQDLISYMPQKFGLYEDLTIQENLELYADLHGVRAQQRE
ERFSRLLQMMDLTRFRDRLAGQLSGGMKQKLGLACTLVRSPQLLLLDEPTVGVDPLSRRE
LWSIIEQLIEQENLTVLISTAYMDEAQRCAQVFVLYQGRLIAQGPPAQLCHLAQGLCYGV
GPEAGTPARLLQARLLDDNEHIIDAVPEGGMVRFIRSAQVPLQAIPSLAGQASPQALEAR
LEDGFMVLLRQQVGSVASLDEPAQAPASYGQGDAASGRAVVIEVRDLVRKFGDFTAVAST
SFEVLKGEIFGLLGPNGAGKTTTFRMLCGLLPASSGYLEVAGVNLRTARAAARRKIGYVS
QKFALYANLSALENLRFFGGAYGLHGAKLKARVALMLEQFDLDEHKHLRSGELPGGYKQR
LAMAVALLHEPQILFLDEPTSGIDPLARRAFWRRITALAQSGTTIVITTHFMEEAEYCDR
IVIQDAGRLLALGTPEQVRHQGSESLADMNSAFIAVVERARAQASAPVQ
selected fasta
>putative ABC transporter ATP-binding protein [PltJ]
ATGAGTGCGCCAGCGGTAACGGTTCAGGCTGTTGAACTGGTCAAGCGCTTTCGCAGTGGA
ACGCGAGAACAGTTGGCTCTGGAGCAGGTTTCTCTGGAGGTGCCCAGTGGCAAGTTGAGT
GCCCTGGTGGGGCCGGACGGGGCCGGAAAAACCACCCTGTTGCGGATGATTGCCGGCTTG
CTCAAGGCCGACGAAGGGCTGTTGAAGGTGCTGGGGCTGGACGTCGCCGCAGATCCGCAG
CAGGTGCAGGACCTCATCAGCTACATGCCCCAGAAGTTCGGCCTGTACGAAGACCTGACG
ATCCAGGAAAACCTCGAACTCTACGCCGACCTGCATGGCGTGCGCGCCCAGCAGCGCGAG
GAGCGCTTTTCCCGGTTGCTGCAGATGATGGACCTGACGCGTTTTCGCGACCGGCTGGCC
GGACAGCTTTCCGGCGGCATGAAACAGAAACTGGGGCTGGCCTGTACCCTGGTCCGTTCA
CCGCAACTGTTGCTGCTGGACGAGCCCACCGTGGGGGTGGATCCGCTGTCGCGGCGGGAA
CTGTGGAGCATCATCGAACAACTGATCGAGCAGGAAAACCTCACGGTGCTGATCAGCACT
GCCTACATGGACGAGGCCCAGCGTTGCGCCCAGGTCTTTGTGCTATACCAGGGGCGGCTG
ATCGCCCAGGGGCCACCGGCGCAGTTGTGCCATCTGGCGCAGGGCCTGTGCTATGGCGTC
GGCCCCGAGGCCGGCACCCCGGCCAGGCTGTTGCAGGCGCGCTTGCTTGACGACAATGAA
CACATCATCGATGCCGTGCCCGAAGGCGGCATGGTTCGCTTTATCCGTAGCGCCCAGGTG
CCTCTGCAGGCCATTCCATCCCTGGCTGGCCAGGCCTCTCCCCAGGCGCTGGAGGCCCGC
CTCGAAGATGGCTTCATGGTGTTGCTCCGGCAACAGGTTGGCAGCGTTGCAAGCCTGGAC
GAGCCGGCGCAGGCGCCCGCCAGCTACGGCCAGGGCGACGCTGCCTCTGGGCGTGCGGTG
GTCATCGAGGTCCGCGACCTGGTGCGCAAGTTCGGGGACTTCACCGCGGTTGCCAGCACC
TCGTTCGAGGTGTTGAAGGGCGAGATATTCGGCTTGCTGGGCCCCAACGGAGCCGGCAAG
ACCACCACGTTTCGCATGCTCTGCGGTTTGCTTCCCGCCTCCAGCGGGTACCTTGAGGTG
GCTGGCGTCAACCTGCGCACCGCACGGGCGGCGGCGCGGCGCAAGATCGGCTACGTCTCG
CAGAAGTTCGCCCTGTACGCGAACCTGTCGGCCCTGGAGAACCTGCGCTTCTTCGGCGGC
GCCTATGGCCTGCACGGCGCGAAGCTGAAAGCGCGGGTGGCGTTGATGCTCGAACAGTTC
GACCTCGACGAACACAAGCACCTGCGCAGCGGCGAGCTGCCCGGTGGCTACAAGCAGCGC
CTGGCCATGGCGGTCGCGCTGCTGCACGAGCCACAGATCCTGTTTCTCGACGAACCCACC
AGCGGTATCGACCCCTTGGCCCGCCGGGCGTTCTGGCGCCGTATCACCGCCCTGGCGCAA
AGCGGCACGACGATCGTGATCACCACCCACTTCATGGAAGAGGCCGAGTACTGCGACCGT
ATCGTCATCCAGGATGCCGGACGGCTGCTGGCCCTGGGCACTCCGGAACAGGTACGCCAC
CAGGGCAGCGAGTCGCTTGCCGACATGAACAGCGCCTTCATTGCCGTGGTCGAGCGTGCT
CGGGCCCAGGCCAGCGCCCCGGTGCAGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR003439 ABC transporter-like (Domain)
 [8-242]  22.489 PS50893 [342-571]  22.302 PS50893
PS50893   ABC_TRANSPORTER_2
 [51-170]  3.6e-22 PF00005 [381-501]  4.5e-16 PF00005
PF00005   ABC_tran
IPR003593 AAA+ ATPase domain (Domain)
 [36-218]  2.3e-10 SM00382 [366-547]  3.1e-16 SM00382
SM00382   ATPases associated with a variety of cellula
IPR017871 ABC transporter, conserved site (Conserved_site)
 [143-157]  PS00211
PS00211   ABC_TRANSPORTER_1
SignalP No significant hit
TMHMM No significant hit