close all open/close all

CDS information : Pyolu_00140


close this sectionLocation

Organism
StrainPf-5
Entry namePyoluteorin
Contig
Start / Stop / Direction26,235 / 27,383 / + [in whole cluster]
26,235 / 27,383 / + [in contig]
Location26235..27383 [in whole cluster]
26235..27383 [in contig]
TypeCDS
Length1,149 bp (382 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category4.3 transport
Productputative ABC transporter permease protein
Product (GenBank)PltK
Gene
Gene (GenBank)pltK
EC number
Keyword
  • type I secretion system
Note
Note (GenBank)
  • predicted transmembrane subunit of ABC transporter
Reference
ACC
PmId
[16269724] Reciprocal regulation of pyoluteorin production with membrane transporter gene expression in Pseudomonas fluorescens Pf-5. (Appl Environ Microbiol. , 2005)
Related Reference
ACC
Q4VWC8
PmId
[16581203] Identification and characterization of a putative ABC transporter PltHIJKN required for pyoluteorin production in Pseudomonas sp. M18. (Gene. , 2006)

close this sectionSequence

selected fasta
>putative ABC transporter permease protein [PltK]
MTMTDSNRSASGFRRRLIALTRKELRQLMRDKSNLAIGIVLPIVLILIFGYGLSLDIRNT
PLAVVLEDSSPSARSVVAKLASSDYFSVVQVTSMAEARALMDKRRVDGIVRVPADFSRRL
EQQDARLQLLLHGADANSAATLGRYVRGALNVWQQQQFDRSRQPQSAGRVLVVERMWFNA
ANSSTWYLVPGLIALIMTLVGAFLTSLVLAREWERGTLESLFVTPVRSIEILLAKIIPYF
LVGLLGLVMCLVSARLLFEVPIQGSLVLLLLSSMLYLLVTLGIGLLISAKTRNQFLASQI
AIIFSFLPALMLSGFLFDLRNVPTFIRVVGSILPATYFMELVKTLFLAGNNWPLIAKNLA
ILAAYAVFLLNAARLCTRKKLD
selected fasta
>putative ABC transporter permease protein [PltK]
ATGACCATGACTGACTCCAATCGATCCGCCTCAGGGTTCAGGCGCAGGCTCATTGCGCTC
ACCCGAAAGGAGTTGCGCCAATTGATGCGTGACAAGAGCAACCTGGCGATAGGCATTGTC
CTGCCCATCGTACTGATCCTGATATTTGGCTACGGCCTGTCCCTGGACATTCGCAACACG
CCGCTGGCCGTGGTCCTGGAAGACAGCTCCCCCAGCGCCCGCAGCGTGGTGGCGAAGCTT
GCGAGTTCGGACTACTTCTCGGTGGTCCAGGTGACCAGCATGGCCGAGGCCCGAGCGCTG
ATGGACAAGCGTCGGGTCGACGGCATCGTGCGCGTGCCGGCGGATTTTTCCAGGCGCCTC
GAACAGCAGGATGCGCGCTTGCAATTGCTCCTGCATGGCGCCGATGCCAACAGCGCGGCG
ACCCTTGGACGCTATGTCAGGGGCGCGCTGAATGTCTGGCAACAGCAGCAGTTCGACCGC
TCCCGGCAGCCCCAGTCGGCCGGTCGGGTGCTGGTCGTCGAACGCATGTGGTTCAACGCC
GCCAACAGCAGTACCTGGTACCTGGTGCCCGGGCTCATCGCCCTGATCATGACCCTGGTG
GGTGCCTTCCTGACCTCTCTGGTACTGGCCCGGGAGTGGGAGCGGGGCACGCTCGAATCA
CTGTTCGTCACCCCGGTCAGGTCGATCGAAATACTCCTGGCCAAGATCATTCCCTATTTC
CTGGTGGGCCTGCTGGGCCTGGTGATGTGCCTGGTTTCGGCGCGGTTGCTGTTCGAGGTA
CCGATCCAGGGTTCGCTGGTGCTCCTGCTGTTGAGCTCCATGCTCTACCTGCTGGTCACC
CTGGGCATTGGCCTGCTGATTTCGGCGAAGACACGCAACCAGTTCCTGGCCAGCCAGATC
GCGATCATCTTCAGCTTCCTGCCGGCGCTGATGCTCTCGGGGTTCCTCTTCGATCTGCGC
AATGTGCCGACGTTCATCCGCGTGGTGGGCTCGATCCTGCCGGCGACTTACTTCATGGAA
CTGGTCAAGACCCTGTTCCTGGCTGGCAACAACTGGCCATTGATCGCCAAGAACCTCGCA
ATCCTCGCGGCCTACGCCGTGTTCCTGTTGAACGCTGCACGCCTGTGCACCCGCAAGAAG
CTGGATTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000412 ABC-2 (Family)
 [139-380]  28.315 PS51012
PS51012   ABC_TM2
SignalP
 [1-1]  Signal-anchor
Eukaryota   
TMHMM
 [33-55]  Transmembrane (i-o) [186-208]  Transmembrane (o-i) [229-251]  Transmembrane (i-o) [266-288]  Transmembrane (o-i) [295-317]  Transmembrane (i-o) [351-373]  Transmembrane (o-i)
Transmembrane 6