close all open/close all

CDS information : Pyolu_00160


close this sectionLocation

Organism
StrainPf-5
Entry namePyoluteorin
Contig
Start / Stop / Direction28,518 / 30,014 / + [in whole cluster]
28,518 / 30,014 / + [in contig]
Location28518..30014 [in whole cluster]
28518..30014 [in contig]
TypeCDS
Length1,497 bp (498 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category4.3 transport
Productputative outer membrane protein
Product (GenBank)PltO
Gene
Gene (GenBank)pltO
EC number
Keyword
  • type I secretion system
Note
Note (GenBank)
  • predicted TolC-type outer membrane efflux protein
Reference
ACC
PmId
[16269724] Reciprocal regulation of pyoluteorin production with membrane transporter gene expression in Pseudomonas fluorescens Pf-5. (Appl Environ Microbiol. , 2005)
Related Reference
ACC
Q4VWC6
PmId
[16581203] Identification and characterization of a putative ABC transporter PltHIJKN required for pyoluteorin production in Pseudomonas sp. M18. (Gene. , 2006)

close this sectionSequence

selected fasta
>putative outer membrane protein [PltO]
MKTTHSGYLRNGLTLAMLLAITACTVGPDFKAPAVTSPERWTDWHSGPPASSVPGKAPAT
TSQTADGNWWQVFGDPVLDQLQAQVREGSPDLHTALLRFAQVRLQRQIVASLETPEVSFS
AAASRNRQSRYAPNNRMLEALGSDSDALEKVLTDPYSLYQAGFDVSWELDLWGRVSRLGE
AAQAEVDGAAATLDDVLLSVSSELARNYFEVRTAQRQTRLLEQEAQILAAHLQVVAVQAR
EGEEDGFAVERQEARLASLHAQIPGWKALHTQAGNRIALLLGEHPGALETLLAERPDNAL
SRPLPNLQLGLPGDLARERPDIRAAQARLHRATAGIGVAEAELYPSVMLGADFGFESYKS
GQFADWSSRTWSVGPRLDLPLFDRGRRSKTVVLRTLEQQEAAVAFHRTVLAAWQEVDDAM
SRYHNEYQRAAHLKDSYDSKARTYEWTRVRYAAGEASYLEELEAQRTVLEAQRDLVNSDS
QLRTHLISIYKSMGGHST
selected fasta
>putative outer membrane protein [PltO]
ATGAAAACTACTCACTCTGGATACCTGCGTAATGGGCTGACGCTGGCCATGCTGCTGGCC
ATCACCGCCTGCACCGTCGGGCCCGATTTCAAGGCGCCGGCAGTTACCAGCCCGGAACGC
TGGACGGATTGGCACAGTGGCCCGCCAGCGTCTTCGGTGCCGGGCAAAGCCCCGGCGACC
ACCTCGCAAACCGCAGACGGCAACTGGTGGCAGGTGTTTGGCGACCCGGTGCTGGACCAG
CTGCAGGCCCAGGTGCGCGAAGGCAGCCCGGACCTGCACACGGCCTTGCTGCGGTTTGCC
CAGGTGCGGTTGCAACGCCAGATAGTCGCTTCCCTGGAAACGCCCGAAGTGTCCTTTTCC
GCGGCGGCTTCGCGAAACCGGCAAAGCCGGTATGCGCCGAACAATCGAATGCTTGAAGCC
TTGGGCAGCGACAGTGATGCCCTGGAAAAGGTGCTTACCGACCCTTATAGCCTGTACCAG
GCCGGGTTCGACGTTTCATGGGAGCTGGATCTCTGGGGGCGGGTGTCACGCCTGGGTGAA
GCCGCCCAGGCCGAGGTCGATGGTGCGGCCGCGACCCTGGACGACGTGTTGCTCAGTGTC
TCCAGCGAGCTGGCGCGAAACTACTTCGAAGTGCGTACCGCACAGCGCCAGACCCGTCTT
CTGGAGCAGGAGGCACAGATCCTGGCCGCGCACCTGCAAGTGGTTGCCGTCCAGGCCCGG
GAGGGCGAGGAAGACGGGTTCGCGGTGGAACGCCAAGAGGCACGGCTGGCCTCGCTGCAT
GCACAGATACCGGGTTGGAAGGCGCTGCACACCCAGGCGGGCAACCGTATTGCGCTGTTG
CTGGGGGAGCATCCCGGAGCCCTGGAAACCTTGCTCGCGGAGCGGCCTGATAATGCCTTG
AGCCGCCCGCTGCCCAACCTGCAGTTGGGCCTGCCTGGCGACCTGGCCCGGGAGCGTCCG
GACATCCGCGCGGCCCAGGCCCGCTTGCATCGGGCGACGGCGGGCATCGGAGTGGCCGAG
GCCGAACTGTACCCGAGCGTGATGCTGGGGGCCGACTTCGGCTTCGAATCCTACAAGAGC
GGCCAGTTTGCCGACTGGAGCAGCCGCACCTGGTCGGTAGGGCCGCGCCTGGACCTGCCG
CTGTTCGACCGTGGGCGGCGCAGCAAGACCGTGGTCCTGCGCACACTCGAACAGCAAGAG
GCGGCCGTGGCATTTCACCGGACCGTACTGGCAGCCTGGCAGGAAGTGGACGATGCGATG
AGCCGCTACCACAACGAATACCAGCGTGCCGCGCACCTCAAGGACAGCTATGACAGCAAG
GCCCGCACCTATGAGTGGACCCGCGTCCGGTACGCGGCCGGGGAGGCCAGCTACCTGGAG
GAACTGGAAGCGCAGCGCACCGTGCTGGAGGCGCAGCGCGACCTGGTCAATAGCGACAGT
CAACTGCGTACTCACCTGATCAGCATTTACAAATCCATGGGTGGGCATTCCACCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR003423 Outer membrane efflux protein (Family)
 [78-264]  1.4e-17 PF02321 [316-494]  1.9e-19 PF02321
PF02321   OEP
IPR010131 RND efflux system, outer membrane lipoprotein, NodT (Family)
 [16-495]  6.9e-89 TIGR01845
TIGR01845   outer_NodT: efflux transporter, outer membrane fac
SignalP
 [1-24]  0.841 Signal
Eukaryota   
 [1-31]  0.875 Signal
Bacteria, Gram-negative   
 [1-34]  0.997 Signal
Bacteria, Gram-positive   
TMHMM No significant hit