close all open/close all

CDS information : Pyolu_00170


close this sectionLocation

Organism
StrainPf-5
Entry namePyoluteorin
Contig
Start / Stop / Direction30,080 / 30,685 / + [in whole cluster]
30,080 / 30,685 / + [in contig]
Location30080..30685 [in whole cluster]
30080..30685 [in contig]
TypeCDS
Length606 bp (201 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.4 hypothetical protein
Producthypothetical protein
Product (GenBank)PltP
Gene
Gene (GenBank)pltP
EC number
Keyword
Note
Note (GenBank)
  • predicted LysE-type outer membrane channel
Reference
ACC
PmId
[16269724] Reciprocal regulation of pyoluteorin production with membrane transporter gene expression in Pseudomonas fluorescens Pf-5. (Appl Environ Microbiol. , 2005)

close this sectionSequence

selected fasta
>hypothetical protein [PltP]
MQMDDLYKIALFSSLILVVPGPSNTLLLASGFKFGVLRSLPLVLIEMLGYTVSICTWGWG
LVLLSHDYPWLIHLIKLLCALYIAALALKTWKTSTTGAQHTERFESWPRHLLIATLLNPK
GLIFASVIFPASSFASLGDFLPSLSAFFLALAPIALLWVSLGAGIRAQYLGRVSGPLFSR
GTAVVLALFSATLTYTVVRAV
selected fasta
>hypothetical protein [PltP]
ATGCAAATGGATGACCTCTACAAGATCGCGCTTTTTTCGTCCCTGATACTGGTAGTGCCG
GGGCCCTCAAACACCTTGCTGCTGGCCTCGGGCTTCAAGTTCGGCGTGTTGCGCTCGCTG
CCACTGGTGTTGATCGAAATGCTCGGCTACACCGTTTCGATCTGCACCTGGGGCTGGGGG
CTTGTGCTGCTGTCCCACGACTACCCGTGGCTGATCCACCTGATCAAGCTGCTGTGCGCC
TTGTACATCGCGGCGCTGGCCTTGAAGACCTGGAAGACCTCCACCACCGGAGCCCAGCAC
ACCGAGCGCTTTGAGAGCTGGCCACGGCACCTGTTGATTGCGACCTTGCTCAACCCCAAG
GGGCTGATCTTCGCCAGTGTGATCTTCCCGGCCAGCTCATTCGCCAGCCTGGGGGATTTC
CTGCCGTCATTGAGCGCTTTCTTCCTGGCACTGGCGCCAATAGCCTTGCTCTGGGTCTCG
CTGGGGGCGGGCATTCGAGCCCAATACCTGGGGCGGGTTTCTGGACCGCTGTTTTCCCGG
GGCACCGCCGTCGTTCTGGCGCTGTTTTCCGCCACCCTCACTTACACCGTGGTTCGTGCG
GTGTAG

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001123 Lysine-type exporter protein (LYSE/YGGA) (Family)
 [16-195]  1.8e-10 PF01810
PF01810   LysE
SignalP
 [1-25]  0.419 Signal
Eukaryota   
TMHMM
 [10-32]  Transmembrane (o-i) [39-61]  Transmembrane (i-o) [71-88]  Transmembrane (o-i) [109-131]  Transmembrane (i-o) [141-163]  Transmembrane (o-i) [176-198]  Transmembrane (i-o)
Transmembrane 6