close all open/close all
Pyolu_00170 Pyolu_00170   last last

CDS information : Pyolu_00180


close this sectionLocation

Organism
StrainPf-5
Entry namePyoluteorin
Contig
Start / Stop / Direction32,668 / 31,523 / - [in whole cluster]
32,668 / 31,523 / - [in contig]
Locationcomplement(31523..32668) [in whole cluster]
complement(31523..32668) [in contig]
TypeCDS
Length1,146 bp (381 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.1 general function
Productputative oxidoreductase
Product (GenBank)predicted zinc-binding oxidoreductase
Gene
Gene (GenBank)
EC number
Keyword
Note
Note (GenBank)
  • orf1
Reference
ACC
PmId
[16269724] Reciprocal regulation of pyoluteorin production with membrane transporter gene expression in Pseudomonas fluorescens Pf-5. (Appl Environ Microbiol. , 2005)
Related Reference
ACC
Q84V25
PmId
[16517758] FaQR, required for the biosynthesis of the strawberry flavor compound 4-hydroxy-2,5-dimethyl-3(2H)-furanone, encodes an enone oxidoreductase. (Plant Cell. , 2006)

close this sectionSequence

selected fasta
>putative oxidoreductase [predicted zinc-binding oxidoreductase]
MRTPGTAAFSSTTRTSWPRSGRSLTTEPHDSNPTQAPPTPIPTDKSRTTMKAFLIDRYGK
NSGRMGEAPTPTLGAHDVLIEVHASSVNVLDSKIRNGEFKLILPYALPLVLGNDLAGVVV
EVGPQVQRFKPGDEVYARPPETRIGTFAQWIAVNENAIALKPANTTMTEAASIPLVALTA
WQVLVETAQLKKGQKVLIHAGAGGVGTLAIQLAKHLGAFVATTTSTANVEWVKALGADQV
IDYKQQNFESLLHGYDLVLNSLGSDVLEKSLKVLKPGGQLISISGPPTVQFAQEQGLAWP
LQQVMRLLSFGIRRKARQRDVRYAFVFMRADGAQLQQITALIEAGIIKPVVDRSFSFEST
AEALQYVEQGRTKGKVVVRIK
selected fasta
>putative oxidoreductase [predicted zinc-binding oxidoreductase]
ATGAGGACGCCGGGCACGGCGGCATTTTCCAGTACCACGCGGACTTCGTGGCCAAGGTCC
GGGCGTTCCTTGACGACAGAGCCCCATGACAGCAACCCCACCCAAGCACCGCCCACACCT
ATTCCAACCGACAAGAGCCGCACCACGATGAAAGCCTTTCTAATTGATCGCTATGGCAAG
AACAGTGGGCGCATGGGCGAAGCGCCCACGCCCACGCTGGGTGCCCACGACGTGTTGATC
GAGGTCCACGCCAGCAGCGTCAACGTGCTGGACTCGAAGATCCGCAACGGCGAATTCAAG
CTGATCCTGCCCTATGCATTGCCGCTGGTACTGGGCAACGACCTGGCGGGCGTCGTGGTT
GAGGTTGGCCCCCAAGTGCAACGCTTCAAGCCGGGAGACGAAGTCTACGCGCGCCCGCCT
GAAACACGGATCGGGACGTTCGCCCAGTGGATCGCCGTGAACGAAAACGCAATCGCCCTG
AAACCTGCCAACACCACCATGACCGAGGCCGCGTCGATCCCCTTGGTCGCACTCACCGCC
TGGCAAGTGCTGGTGGAAACCGCCCAACTGAAAAAGGGCCAGAAAGTGCTGATCCACGCA
GGCGCAGGCGGTGTCGGCACCCTTGCCATCCAGCTGGCCAAACACCTCGGCGCTTTCGTC
GCGACCACCACCAGCACGGCGAATGTCGAATGGGTCAAAGCCCTGGGCGCCGATCAGGTG
ATCGACTACAAGCAGCAGAACTTCGAAAGCCTCTTGCATGGCTACGACCTGGTGTTGAAC
AGCCTGGGCAGCGACGTACTGGAAAAGTCCCTCAAGGTCCTCAAGCCCGGCGGACAGCTG
ATTTCCATCTCCGGGCCACCCACGGTGCAATTCGCCCAGGAGCAAGGGCTGGCCTGGCCG
TTGCAGCAGGTCATGCGCCTCTTGAGCTTCGGTATCCGGCGCAAGGCGCGCCAGCGGGAC
GTCCGCTACGCCTTTGTGTTCATGCGGGCCGATGGCGCCCAGCTGCAACAGATCACCGCG
CTGATCGAGGCCGGAATCATCAAGCCTGTGGTTGACCGCAGCTTCAGTTTCGAATCGACG
GCAGAGGCCTTGCAGTACGTCGAGCAGGGACGAACCAAGGGCAAGGTGGTGGTCAGGATC
AAATGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR002364 Quinone oxidoreductase/zeta-crystallin, conserved site (Conserved_site)
 [193-214]  PS01162
PS01162   QOR_ZETA_CRYSTAL
IPR011032 GroES-like (Domain)
 [50-211]  6.60002751141562e-43 SSF50129
SSF50129   GroES_like
IPR013154 Alcohol dehydrogenase GroES-like (Domain)
 [76-139]  7.59999999999999e-12 PF08240
PF08240   ADH_N
IPR016040 NAD(P)-binding domain (Domain)
 [158-354]  3.29999999999997e-45 G3DSA:3.40.50.720
G3DSA:3.40.50.720   NAD(P)-bd
SignalP
 [1-23]  0.564 Signal
Bacteria, Gram-positive   
 [1-15]  0.55 Signal
Bacteria, Gram-negative   
TMHMM No significant hit
Pyolu_00170 Pyolu_00170   last last