close all open/close all
first first   Pyrlo_00020 Pyrlo_00020

CDS information : Pyrlo_00010


close this sectionLocation

Organism
StrainATCC 31673 (=NBRC 14294)
Entry namePyrrolomycin
Contig
Start / Stop / Direction1 / 843 / + [in whole cluster]
1 / 843 / + [in contig]
Location1..843 [in whole cluster]
1..843 [in contig]
TypeCDS
Length843 bp (280 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.1 general function
Productputative sulfurtransferase
Product (GenBank)formate dehydrogenase
Gene
Gene (GenBank)
EC number
Keyword
Note
  • It is supposed that this ORF is not involved in pyrrolomycin biosynthesis.
Note (GenBank)
  • orf1
Reference
ACC
PmId
[17158935] Cloning and characterization of the pyrrolomycin biosynthetic gene clusters from Actinosporangium vitaminophilum ATCC 31673 and Streptomyces sp. strain UC 11065. (Antimicrob Agents Chemother. , 2007)
Related Reference
ACC
P39756
PmId
[7860592] Identification and isolation of a gene required for nitrate assimilation and anaerobic growth of Bacillus subtilis. (J Bacteriol. , 1995)
ACC
C5A063
PmId
[22194618] A sulfurtransferase is essential for activity of formate dehydrogenases in Escherichia coli. (J Biol Chem. , 2012)

close this sectionSequence

selected fasta
>putative sulfurtransferase [formate dehydrogenase]
MGRVTARRPVVRVRDGEVSRRVDTLVAEEPLEIRLNGKPLAITMRTPGDDFALAVGFLVS
EGVVADASDVSRIAYCAGATADGSNTYNVVDVRLAPGVPVPDITLERNVYTTSSAAVRQG
QPGRGADTARWPVAGPGPRLRPDVLSALPDALRAAQGVFHQTGGLHAAGLFTPDGDVLDV
REDVGRHNAVDKLVGRAYQQGALPVRDTVLLVSGRASFELVQKAVMAGIPALAAVSAPSS
LAVELAAETGLTLVGFLRGRSMNVYAGAERVVLEPSGSRN
selected fasta
>putative sulfurtransferase [formate dehydrogenase]
ATGGGACGGGTCACCGCCCGCCGCCCGGTGGTGCGGGTGCGCGACGGCGAGGTCAGCCGA
CGGGTGGACACCCTCGTCGCCGAGGAGCCGCTGGAGATCCGGCTGAACGGGAAGCCGCTG
GCCATCACCATGCGCACCCCCGGCGACGACTTCGCACTCGCCGTCGGGTTCCTGGTCAGC
GAAGGTGTCGTGGCCGACGCCTCGGACGTCTCCCGCATCGCGTACTGCGCGGGCGCCACG
GCGGACGGCAGCAACACCTACAACGTGGTGGACGTTCGCCTCGCCCCCGGTGTGCCGGTG
CCGGACATCACCCTGGAACGCAACGTCTACACCACCTCCTCTGCGGCTGTGCGGCAAGGC
CAGCCTGGACGCGGTGCGGACACCGCCCGGTGGCCGGTGGCCGGTCCCGGGCCACGGCTG
CGGCCCGACGTCCTGTCCGCGCTGCCGGACGCGTTGCGCGCGGCCCAGGGGGTTTTCCAC
CAGACCGGGGGGCTGCACGCCGCCGGGCTGTTCACCCCGGACGGCGACGTGCTCGACGTC
CGCGAGGACGTGGGTCGGCACAACGCCGTGGACAAGCTGGTCGGCCGGGCGTACCAGCAG
GGTGCGCTGCCCGTGCGGGACACGGTGCTGCTCGTCTCCGGCAGGGCGTCGTTCGAACTC
GTCCAGAAGGCGGTGATGGCCGGCATCCCCGCGTTGGCCGCCGTCTCCGCGCCCTCCTCG
CTGGCGGTCGAGCTGGCCGCGGAGACCGGCCTCACCCTCGTGGGTTTCCTGCGGGGACGG
TCCATGAACGTCTACGCGGGTGCGGAGCGGGTCGTCCTGGAACCGTCCGGGTCGCGGAAC
TGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR003786 Formate dehydrogenase, subunit FdhD (Family)
 [26-271]  2.09999999999996e-75 PF02634
PF02634   FdhD-NarQ
 [1-273]  3.699978135861e-106 PIRSF015626
PIRSF015626   FdhD
SignalP No significant hit
TMHMM No significant hit
first first   Pyrlo_00020 Pyrlo_00020