close all open/close all

CDS information : Pyrlo_00030


close this sectionLocation

Organism
StrainATCC 31673 (=NBRC 14294)
Entry namePyrrolomycin
Contig
Start / Stop / Direction3,199 / 2,579 / - [in whole cluster]
3,199 / 2,579 / - [in contig]
Locationcomplement(2579..3199) [in whole cluster]
complement(2579..3199) [in contig]
TypeCDS
Length621 bp (206 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category4.1 transcriptional regulator
Productputative TetR family transcriptional regulator
Product (GenBank)TetR family regulator
Gene
Gene (GenBank)pyr3
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[17158935] Cloning and characterization of the pyrrolomycin biosynthetic gene clusters from Actinosporangium vitaminophilum ATCC 31673 and Streptomyces sp. strain UC 11065. (Antimicrob Agents Chemother. , 2007)
Family/Domain
FD
IPR001647

close this sectionSequence

selected fasta
>putative TetR family transcriptional regulator [TetR family regulator]
MPRVSEEHRVARRQQIIDAAHRCIVENGFHQTSMQDVINESGLSAGAVYRYFTGKEELIR
AVAEKASVHFAEAMAKVVSEHPSLSWDQALARLLSGLMSDLDESRAGTARLAVQIWGEAQ
RDPVVAEAALGALVAAQRRMHSLVVQLQDTGRIPKSGDAGQISQALLSFLLGCIVQSMLM
EDVDLEGLAHGLAALPSPVELERAGG
selected fasta
>putative TetR family transcriptional regulator [TetR family regulator]
ATGCCACGAGTAAGCGAGGAGCACCGCGTTGCTCGTCGTCAGCAGATCATTGACGCCGCG
CACCGGTGCATTGTGGAGAACGGCTTCCACCAGACGTCCATGCAGGACGTGATCAACGAA
TCCGGGTTGTCGGCTGGCGCGGTGTACCGCTACTTCACCGGCAAGGAGGAGTTGATCCGG
GCCGTCGCGGAGAAGGCCAGCGTGCATTTCGCCGAGGCGATGGCGAAGGTGGTCAGTGAG
CACCCGTCGCTCTCCTGGGACCAGGCCCTGGCCCGTCTGCTCTCCGGACTCATGTCCGAC
CTGGACGAGAGCCGGGCGGGCACCGCGCGCCTGGCCGTGCAGATATGGGGGGAGGCGCAG
CGCGACCCGGTGGTGGCCGAGGCCGCCCTGGGGGCGCTGGTCGCGGCGCAGCGGCGGATG
CACTCCCTGGTGGTACAGCTCCAGGACACCGGACGGATACCGAAGTCGGGCGACGCCGGG
CAGATCAGTCAGGCGTTGCTGTCCTTCCTGCTCGGCTGCATCGTGCAGTCCATGTTGATG
GAGGACGTTGACCTCGAGGGCCTCGCCCACGGCCTCGCCGCCCTGCCGAGCCCGGTGGAG
CTGGAACGCGCCGGGGGCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001647 DNA-binding HTH domain, TetR-type (Domain)
 [10-70]  PS50977
PS50977   HTH_TETR_2
 [16-29]  2.90000036269908e-08 PR00455 [37-60]  2.90000036269908e-08 PR00455
PR00455   HTHTETR
 [16-62]  7.29999999999998e-17 PF00440
PF00440   TetR_N
IPR009057 Homeodomain-like (Domain)
 [1-81]  3.0999994589937e-19 SSF46689
SSF46689   Homeodomain_like
IPR011075 Tetracycline transcriptional regulator, TetR-related, C-terminal (Domain)
 [84-195]  9.00000407957274e-11 SSF48498
SSF48498   TetR_like_C
IPR015893 Tetracycline transcriptional regulator, TetR-like, C-terminal (Domain)
 [7-187]  4.70000000000003e-35 G3DSA:1.10.357.10
G3DSA:1.10.357.10   TetR_C
IPR023772 DNA-binding HTH domain, TetR-type, conserved site (Conserved_site)
 [28-59]  PS01081
PS01081   HTH_TETR_1
SignalP No significant hit
TMHMM No significant hit