close all open/close all

CDS information : Pyrlo_00040


close this sectionLocation

Organism
StrainATCC 31673 (=NBRC 14294)
Entry namePyrrolomycin
Contig
Start / Stop / Direction3,490 / 5,427 / + [in whole cluster]
3,490 / 5,427 / + [in contig]
Location3490..5427 [in whole cluster]
3490..5427 [in contig]
TypeCDS
Length1,938 bp (645 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.1 general function
Productputative 2-oxoglutarate ferredoxin oxidoreductase alpha subunit
Product (GenBank)2-oxoglutarate ferredoxin oxidoreductase alpha subunit
Gene
Gene (GenBank)pyr4
EC number1.2.7.3
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[17158935] Cloning and characterization of the pyrrolomycin biosynthetic gene clusters from Actinosporangium vitaminophilum ATCC 31673 and Streptomyces sp. strain UC 11065. (Antimicrob Agents Chemother. , 2007)
Related Reference
ACC
Q9AJM0
PmId
[11401501] The genes for anabolic 2-oxoglutarate: ferredoxin oxidoreductase from Hydrogenobacter thermophilus TK-6. (Biochem Biophys Res Commun. , 2001)
[16978355] Role of two 2-oxoglutarate:ferredoxin oxidoreductases in Hydrogenobacter thermophilus under aerobic and anaerobic conditions. (FEMS Microbiol Lett. , 2006)

close this sectionSequence

selected fasta
>putative 2-oxoglutarate ferredoxin oxidoreductase alpha subunit [2-oxoglutarate ferredoxin oxidoreductase alpha subunit]
MPQSNHSTWATKGRAVTSSVIREKPVRRLDRVVIRFAGDSGDGMQLTGDRFTSETAVFGN
DLSTLPNFPAEIRAPAGTLPGVSSFQLHFADHDILTPGDAPDVLVAMNPAALKANLPDLP
AGAEIIVNTDEFSKRALAKVGWSSNPLDEGSPVLSAWRVHRVPLTSLTLAALESFGLPRK
DAERAKNMFALGLLSWMYHRPTAGTEAFLRRKFAKKPTIAEANLAAFRAGVNFGETTEDF
AVSYEIAPAALPAGRYRNISGNLALSYGLVAASQRADLPLFLGSYPITPASDILHELSRH
KNFGVRTFQAEDEIAGIGAALGAAFGGALAVTTTSGPGIALKAETVGLAVSLELPLLVID
IQRGGPSTGLPTKTEQADLLQAMYGRNGEAPVPVLAPATPADCFDVAVDAARIALTYRTP
VFVLSDGYLANGSEPWRVPDPAQLPDLRVRFATGPNHTLDDGTEVFWPYKRDPHTLARPW
AVPGTPGLEHRIGGIEKQDGTGNISYDPANHDLMVRTRQAKIDRIEVPDVTVDDPGCDTH
GPAPLLVLGWGSTYGPITAAVRRVRATGRRVAQAHLRHLNPFPHNLDRVLSTYTNVLIPE
MNLGQLATLIRARYLIDARSYTQVRGLPFKAEQLATAITEATDHD
selected fasta
>putative 2-oxoglutarate ferredoxin oxidoreductase alpha subunit [2-oxoglutarate ferredoxin oxidoreductase alpha subunit]
ATGCCTCAGAGCAACCACAGCACATGGGCTACGAAGGGGCGGGCAGTGACCAGCTCAGTC
ATACGGGAGAAGCCGGTAAGGCGCCTGGATCGGGTGGTTATTCGGTTTGCGGGCGATTCC
GGTGATGGGATGCAGCTCACTGGTGACCGTTTCACCTCGGAGACTGCGGTGTTCGGTAAC
GACTTGTCGACGTTGCCGAACTTTCCTGCGGAGATCCGTGCGCCGGCTGGGACGTTGCCG
GGTGTGTCGTCGTTCCAGTTGCATTTCGCGGATCATGACATCCTCACTCCTGGTGATGCT
CCGGATGTGTTGGTGGCGATGAACCCGGCGGCGTTGAAGGCGAACCTGCCGGACCTGCCC
GCGGGGGCGGAGATCATCGTGAACACGGACGAGTTCTCCAAGCGGGCGTTGGCGAAGGTG
GGCTGGTCGAGTAACCCGTTGGATGAGGGTTCGCCGGTGTTGTCGGCGTGGCGGGTGCAT
CGGGTGCCGTTGACGAGTTTGACGTTGGCGGCGTTGGAGTCGTTCGGTCTGCCGCGTAAG
GACGCGGAGCGGGCGAAGAACATGTTCGCTTTGGGTTTGTTGTCGTGGATGTACCATCGG
CCGACCGCGGGTACCGAGGCGTTCCTGCGGCGGAAGTTCGCCAAGAAGCCCACCATCGCC
GAGGCGAACCTGGCGGCGTTCCGCGCGGGGGTGAACTTCGGTGAGACCACCGAGGACTTC
GCGGTGTCGTACGAGATCGCGCCGGCGGCGTTGCCGGCGGGCCGGTACCGGAACATCTCG
GGGAACCTGGCCTTGTCCTACGGGTTGGTCGCGGCCTCGCAGCGGGCGGACCTGCCGTTG
TTCTTGGGTTCGTATCCGATCACTCCGGCGTCGGACATCTTGCACGAGTTGTCGCGGCAC
AAGAACTTCGGGGTGCGTACGTTCCAGGCCGAGGACGAGATCGCGGGGATCGGCGCGGCG
TTGGGTGCGGCGTTCGGTGGGGCGTTGGCGGTGACCACGACGTCGGGGCCGGGGATCGCG
TTGAAGGCGGAGACGGTGGGGTTGGCGGTGTCGTTGGAGTTGCCGTTGCTGGTGATCGAT
ATCCAGCGTGGTGGCCCGTCGACGGGGTTGCCGACCAAGACCGAGCAGGCTGATCTGTTG
CAGGCGATGTACGGGCGTAACGGTGAGGCGCCGGTGCCGGTGTTGGCTCCGGCGACTCCG
GCGGACTGTTTCGATGTCGCTGTGGACGCGGCGCGGATCGCGTTGACGTACCGCACTCCG
GTGTTCGTGTTGTCTGATGGGTATCTGGCCAACGGCTCGGAGCCGTGGCGGGTCCCTGAC
CCCGCGCAGTTGCCGGACCTTCGGGTGCGGTTCGCCACCGGCCCGAACCACACCCTGGAC
GATGGCACCGAGGTGTTCTGGCCCTACAAGCGTGACCCGCACACCCTGGCCAGGCCGTGG
GCGGTGCCGGGCACCCCGGGCCTGGAACACCGTATCGGCGGGATCGAGAAGCAGGACGGC
ACCGGGAACATCTCCTACGACCCGGCGAACCACGACCTGATGGTCCGCACCCGCCAGGCC
AAGATCGACCGGATCGAGGTCCCGGACGTGACCGTGGACGACCCCGGATGCGACACCCAC
GGCCCCGCCCCGCTGCTGGTGCTGGGCTGGGGATCGACCTACGGGCCGATCACCGCCGCG
GTGCGCAGGGTCCGCGCCACCGGACGGCGCGTCGCCCAGGCACACCTACGCCACCTCAAC
CCCTTCCCCCACAACCTCGACCGCGTGCTGTCCACCTACACCAACGTCCTGATCCCGGAA
ATGAACCTCGGGCAACTCGCCACCCTCATCCGCGCCCGCTACCTGATCGACGCCCGCTCC
TACACCCAGGTCCGCGGCCTGCCGTTCAAGGCCGAACAGCTCGCCACCGCCATCACGGAG
GCCACCGACCATGACTAG

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR002869 Pyruvate-flavodoxin oxidoreductase, central domain (Domain)
 [30-254]  6.69999687625999e-16 SSF53323
SSF53323   Pyrv_Fd/Flavodoxin_OxRdtase
IPR002880 Pyruvate flavodoxin/ferredoxin oxidoreductase, N-terminal (Domain)
 [281-495]  8.10000000000001e-52 PF01855
PF01855   POR_N
IPR009014 Transketolase, C-terminal/Pyruvate-ferredoxin oxidoreductase, domain II (Domain)
 [533-644]  1.09999909120787e-10 SSF52922
SSF52922   Transketo_C_like
IPR015941 Transketolase-like, C-terminal (Domain)
 [545-615]  4.29999999999999e-08 G3DSA:3.40.50.920
G3DSA:3.40.50.920   Transketo_C_like
IPR019752 Pyruvate/ketoisovalerate oxidoreductase, catalytic domain (Domain)
 [40-231]  1.2e-27 PF01558
PF01558   POR
 [32-233]  2.5e-12 G3DSA:3.40.920.10
G3DSA:3.40.920.10   Pyrv_Fd/Flavodoxin_OxRdtase
IPR022367 2-oxoacid:acceptor oxidoreductase, alpha subunit (Family)
 [32-638]  TIGR03710
TIGR03710   OAFO_sf
SignalP No significant hit
TMHMM No significant hit