close all open/close all

CDS information : Pyrlo_00050


close this sectionLocation

Organism
StrainATCC 31673 (=NBRC 14294)
Entry namePyrrolomycin
Contig
Start / Stop / Direction5,513 / 6,580 / + [in whole cluster]
5,513 / 6,580 / + [in contig]
Location5513..6580 [in whole cluster]
5513..6580 [in contig]
TypeCDS
Length1,068 bp (355 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.1 general function
Productputative 2-oxoglutarate ferredoxin oxidoreductase beta subunit
Product (GenBank)2-oxoglutarate ferredoxin oxidoreductase beta subunit
Gene
Gene (GenBank)pyr5
EC number1.2.7.3
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[17158935] Cloning and characterization of the pyrrolomycin biosynthetic gene clusters from Actinosporangium vitaminophilum ATCC 31673 and Streptomyces sp. strain UC 11065. (Antimicrob Agents Chemother. , 2007)
Related Reference
ACC
Q9AJL9
PmId
[11401501] The genes for anabolic 2-oxoglutarate: ferredoxin oxidoreductase from Hydrogenobacter thermophilus TK-6. (Biochem Biophys Res Commun. , 2001)
[16978355] Role of two 2-oxoglutarate:ferredoxin oxidoreductases in Hydrogenobacter thermophilus under aerobic and anaerobic conditions. (FEMS Microbiol Lett. , 2006)

close this sectionSequence

selected fasta
>putative 2-oxoglutarate ferredoxin oxidoreductase beta subunit [2-oxoglutarate ferredoxin oxidoreductase beta subunit]
MRHPLALVPTTDTKQTARDFKSDQEVRWCPGCGDYAILAAVQGFLPDLGIARENIVFISG
IGCSSRFPYYMNTYGMHSIHGRAPAIATGLSTTRPDLSVWVITGDGDALSIGGNHLIHAL
RRNVNLNILLFNNRIYGLTKGQYSPTSETGKITKSTPMGSLDTPFNPISLALGAEASFVA
RTIDSDRTHLTDTLRQAAHHPGTSLVEIYQNCNIFNDGAFEPLKNKDTQHHHLIRLTHGQ
PIRFGPPAPDGHGSKALTRNPTTGTLEITDLTQTPNPPNILIHDAHNPDPTTAYALSRLA
DPHTLTHTPIGVFRDITRPVYDHTMTHQLDHATEHQGKGDLAALLAGNDTWTVTR
selected fasta
>putative 2-oxoglutarate ferredoxin oxidoreductase beta subunit [2-oxoglutarate ferredoxin oxidoreductase beta subunit]
GTGCGTCACCCGCTGGCGCTGGTGCCCACCACCGACACCAAGCAAACCGCCCGGGACTTC
AAGTCCGACCAGGAAGTGCGCTGGTGCCCCGGCTGCGGCGACTACGCCATCCTCGCCGCC
GTCCAAGGCTTCCTACCCGACCTGGGCATCGCCCGCGAGAACATCGTGTTCATCTCCGGG
ATCGGCTGCTCCTCCCGATTCCCCTACTACATGAACACCTACGGGATGCACTCCATCCAC
GGCCGCGCCCCCGCCATCGCCACCGGACTGTCCACCACCCGCCCCGACCTGTCCGTCTGG
GTCATCACCGGCGACGGCGACGCCCTGTCCATCGGCGGCAACCACCTCATCCACGCCCTA
CGCCGCAACGTCAACCTCAACATCCTGCTGTTCAACAACCGCATCTACGGCCTCACCAAA
GGCCAGTACTCCCCCACCTCAGAAACCGGCAAAATCACCAAATCCACCCCCATGGGAAGC
CTCGACACCCCCTTCAACCCCATCTCCCTCGCCCTGGGAGCCGAAGCCTCCTTCGTCGCC
CGCACCATCGACTCCGACCGCACCCACCTCACCGACACCCTCCGCCAAGCCGCCCACCAC
CCCGGCACCTCCCTCGTCGAGATCTACCAAAACTGCAACATCTTCAACGACGGCGCCTTC
GAACCCCTGAAGAACAAAGACACCCAACACCACCACCTCATCCGCCTCACCCACGGCCAA
CCCATCCGCTTCGGCCCCCCCGCCCCCGACGGACACGGCAGCAAAGCCCTCACCCGCAAC
CCCACCACCGGCACCCTCGAAATCACCGACCTCACCCAAACCCCCAACCCCCCCAACATC
CTCATCCACGACGCCCACAACCCCGACCCCACCACCGCCTACGCCCTCTCCCGCCTCGCC
GACCCCCACACCCTCACCCACACCCCCATCGGCGTCTTCCGCGACATCACCCGCCCCGTC
TACGACCACACCATGACCCACCAACTCGACCACGCCACCGAACACCAGGGCAAAGGCGAC
CTCGCCGCCCTCCTGGCAGGAAACGACACCTGGACCGTCACCCGCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR011766 Thiamine pyrophosphate enzyme, C-terminal TPP-binding (Domain)
 [61-208]  2.1e-29 PF02775
PF02775   TPP_enzyme_C
SignalP No significant hit
TMHMM No significant hit