close all open/close all

CDS information : Pyrlo_00060


close this sectionLocation

Organism
StrainATCC 31673 (=NBRC 14294)
Entry namePyrrolomycin
Contig
Start / Stop / Direction6,626 / 8,065 / + [in whole cluster]
6,626 / 8,065 / + [in contig]
Location6626..8065 [in whole cluster]
6626..8065 [in contig]
TypeCDS
Length1,440 bp (479 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category4.3 transport
Productputative transporter
Product (GenBank)membrane antiporter
Gene
Gene (GenBank)pyr6
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[17158935] Cloning and characterization of the pyrrolomycin biosynthetic gene clusters from Actinosporangium vitaminophilum ATCC 31673 and Streptomyces sp. strain UC 11065. (Antimicrob Agents Chemother. , 2007)
Family/Domain
FD
IPR006153

close this sectionSequence

selected fasta
>putative transporter [membrane antiporter]
MSSNHEHAEWIVTVAIGDVALVLAVGTLFVLLARRIKQPAVIGEITAGICLGPSLLGLLP
GDLPEQLFPSDVRPYLNVVAQIGLLLFMFIIGWEFDYASMRGRRKKLGTIWICAAALPLS
MGMGLAVLLHGSNDVVNGKHIRMVDFALYIGIAMSIAAFPVLARIITDHRLQFTRVGTLA
LALAALDDILAWSMLAVVVALVTASGTGGFLSVIGWGAVYIVVMLVIVRPALAYLARKIT
SASAPYLAVAAAAGTLCSAYITSEIGLHAIFGAFVFGLVMPRGPQPELMHRAAMVPLENV
SKLLLPLFFVVTGLSVDLTAMTSDGLIQMTLIICVAITGKLGGVLLSARVTGMSWQDSTI
LGLLMNTRGLTELVILNVGLSLGLLSVELFTAMVMMALVTTGMTSPILSMMLRRAAPHSE
AAVPAHLKDGGDESDASAAAVPSAANGSGPVAGVENGASPVHRDEAGRNSYLPTPQGGD
selected fasta
>putative transporter [membrane antiporter]
GTGAGCAGTAACCACGAACACGCGGAGTGGATCGTCACCGTCGCCATCGGTGACGTGGCG
TTGGTCCTCGCCGTCGGAACGCTATTCGTGCTGCTGGCGCGCCGCATCAAGCAGCCCGCG
GTCATCGGCGAGATCACCGCCGGCATCTGCCTGGGGCCCAGCCTGCTCGGACTCCTTCCG
GGTGACCTCCCCGAGCAGCTCTTCCCCAGCGACGTCAGGCCCTACCTCAACGTCGTCGCC
CAGATCGGCCTCCTGCTGTTCATGTTCATCATCGGCTGGGAGTTCGACTACGCCTCGATG
CGCGGGCGCCGCAAGAAACTGGGGACCATCTGGATCTGCGCCGCCGCCCTGCCCCTGTCC
ATGGGCATGGGGCTCGCCGTGCTCCTGCACGGCTCCAACGACGTGGTCAACGGCAAGCAC
ATCCGCATGGTCGACTTCGCCCTCTACATCGGCATCGCCATGTCGATCGCCGCCTTCCCC
GTGCTGGCGCGGATCATCACCGACCACCGGCTCCAGTTCACCCGGGTCGGCACGCTGGCC
CTGGCGCTCGCCGCCCTGGACGACATCCTCGCCTGGTCCATGCTGGCGGTGGTGGTGGCC
CTGGTCACGGCGTCCGGCACCGGCGGGTTCCTCAGCGTCATCGGCTGGGGCGCGGTCTAC
ATCGTGGTGATGCTGGTCATCGTCCGCCCCGCACTGGCCTACCTGGCCCGCAAGATCACC
AGCGCCTCCGCCCCCTACCTGGCGGTGGCCGCCGCGGCCGGCACCCTGTGCTCCGCCTAC
ATCACCTCGGAGATCGGCCTGCACGCCATCTTCGGGGCGTTCGTCTTCGGCCTGGTGATG
CCGCGCGGGCCGCAACCCGAGCTGATGCACCGGGCGGCCATGGTGCCGCTGGAGAACGTC
AGCAAGCTGCTGCTCCCCCTGTTCTTCGTGGTCACCGGACTGTCCGTGGACCTGACCGCG
ATGACCTCGGACGGGCTGATCCAGATGACCCTGATCATCTGCGTCGCCATCACCGGAAAG
CTGGGCGGCGTCCTGCTCTCGGCCAGGGTGACCGGCATGAGCTGGCAGGACTCCACCATC
CTCGGCCTGCTGATGAACACCCGGGGCCTGACCGAACTCGTCATCCTCAACGTCGGTTTG
AGCCTGGGTCTGCTGAGCGTCGAGCTGTTCACCGCAATGGTGATGATGGCGCTGGTCACC
ACGGGCATGACCTCCCCCATCCTGTCGATGATGCTCCGCAGGGCCGCGCCCCACTCGGAG
GCAGCAGTGCCCGCACACCTCAAGGACGGCGGCGACGAGTCCGACGCGTCAGCGGCGGCC
GTGCCGAGTGCCGCGAACGGCTCCGGCCCCGTGGCCGGCGTGGAGAACGGCGCCTCGCCC
GTGCACCGCGACGAGGCCGGCAGGAACAGCTATCTCCCCACCCCCCAGGGCGGGGACTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR006153 Cation/H+ exchanger (Domain)
 [21-413]  4.6e-60 PF00999
PF00999   Na_H_Exchanger
SignalP
 [1-33]  0.43 Signal
Eukaryota   
TMHMM
 [10-32]  Transmembrane (o-i) [39-61]  Transmembrane (i-o) [76-95]  Transmembrane (o-i) [107-129]  Transmembrane (i-o) [144-166]  Transmembrane (o-i) [179-201]  Transmembrane (i-o) [206-228]  Transmembrane (o-i) [249-271]  Transmembrane (i-o) [326-348]  Transmembrane (o-i) [373-395]  Transmembrane (i-o)
Transmembrane 10