close all open/close all

CDS information : Pyrlo_00070


close this sectionLocation

Organism
StrainATCC 31673 (=NBRC 14294)
Entry namePyrrolomycin
Contig
Start / Stop / Direction8,174 / 9,313 / + [in whole cluster]
8,174 / 9,313 / + [in contig]
Location8174..9313 [in whole cluster]
8174..9313 [in contig]
TypeCDS
Length1,140 bp (379 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.2 modification addition of starter unit
Productputative L-prolyl-PCP dehydrogenase
Product (GenBank)acyl-CoA dehydrogenase
Gene
Gene (GenBank)pyr7
EC number
Keyword
  • pyrrole ring moiety
Note
Note (GenBank)
Reference
ACC
PmId
[17158935] Cloning and characterization of the pyrrolomycin biosynthetic gene clusters from Actinosporangium vitaminophilum ATCC 31673 and Streptomyces sp. strain UC 11065. (Antimicrob Agents Chemother. , 2007)
Related Reference
ACC
Q9X3R3
NITE
Pyolu_00080
PmId
[11880032] Conversion of L-proline to pyrrolyl-2-carboxyl-S-PCP during undecylprodigiosin and pyoluteorin biosynthesis. (Chem Biol. , 2002)

close this sectionSequence

selected fasta
>putative L-prolyl-PCP dehydrogenase [acyl-CoA dehydrogenase]
MEFGWTQEQQARYDETLAAVREAFPGDQPPSTQYYSRADFKRLGDLGLLGPSVPTRYGGG
GLGALDTARLVEALGRGCAETGLVFGASAHTFACAMPVVDFGTEEVRKRVLPGLCSGELI
AGNAITEAESGSDVSRLAVTARRVDGGWVLNGEKSFVSNGPVSDVFITYGTTDPKAGPFG
VTGFVVERSAEGVFPSEPFDKMGLLQCPAGSVRFADTFVPDENVLGEPGQGGWIFQHSMG
WERACLFAGYVGLADRVIESCIAHVRGRRQFGKRLSEFQAVSHRIADMKLRLESARLLLY
RACWEMDQGAPATLSIALSKLAVSEGVLASALDAVRIFGGRGYQRDHGIEAALRDAVPSV
IFSGTSDIQRELIARELGL
selected fasta
>putative L-prolyl-PCP dehydrogenase [acyl-CoA dehydrogenase]
GTGGAGTTCGGCTGGACCCAAGAGCAACAGGCGCGATACGACGAGACGCTCGCCGCCGTC
CGGGAGGCGTTCCCCGGCGACCAACCGCCCTCGACCCAGTACTACAGCCGCGCGGACTTC
AAGCGTCTGGGCGACCTCGGCCTGCTCGGACCCTCGGTGCCGACCCGCTACGGCGGCGGC
GGACTCGGGGCGCTCGACACCGCCCGGCTGGTGGAGGCGCTGGGACGGGGCTGCGCCGAG
ACCGGTCTGGTCTTCGGCGCGAGCGCCCACACGTTCGCCTGCGCCATGCCGGTGGTGGAC
TTCGGTACCGAGGAGGTCCGCAAGCGGGTCCTGCCCGGGCTGTGCAGCGGCGAGCTGATC
GCCGGCAACGCCATCACCGAGGCCGAGTCGGGCTCGGACGTCTCCCGTCTGGCGGTCACC
GCACGACGCGTGGACGGCGGGTGGGTGCTGAACGGGGAGAAGAGCTTCGTCAGCAACGGC
CCGGTCTCGGACGTCTTCATCACCTACGGCACCACCGACCCCAAGGCCGGGCCGTTCGGG
GTGACCGGCTTCGTGGTGGAGCGCTCGGCCGAGGGGGTGTTCCCCAGCGAGCCCTTCGAC
AAGATGGGCCTGCTCCAGTGCCCCGCGGGGAGCGTGCGCTTCGCGGACACGTTCGTCCCG
GACGAGAACGTGCTCGGCGAACCCGGCCAGGGGGGCTGGATATTCCAGCACTCCATGGGC
TGGGAGCGGGCGTGCCTGTTCGCGGGCTACGTCGGCCTCGCCGACCGGGTGATCGAGAGC
TGCATCGCCCACGTACGGGGACGGCGCCAGTTCGGCAAGCGGCTGTCCGAGTTCCAGGCG
GTGTCCCACCGCATCGCCGACATGAAACTCCGCCTGGAGAGCGCGCGGCTGCTGCTCTAC
CGGGCCTGCTGGGAGATGGACCAGGGGGCCCCGGCCACGCTGTCCATCGCGCTGTCCAAG
CTCGCCGTGTCCGAGGGCGTGCTGGCGAGCGCGCTGGACGCGGTGCGGATCTTCGGTGGT
CGTGGCTACCAGCGCGACCACGGCATCGAGGCGGCACTGCGGGACGCGGTGCCCTCGGTG
ATCTTCTCGGGCACCTCCGACATCCAGCGGGAACTCATCGCAAGGGAGCTGGGGCTATGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR006090 Acyl-CoA oxidase/dehydrogenase, type 1 (Domain)
 [234-377]  1.9e-37 PF00441
PF00441   Acyl-CoA_dh_1
IPR006091 Acyl-CoA oxidase/dehydrogenase, central domain (Domain)
 [124-173]  1e-16 PF02770
PF02770   Acyl-CoA_dh_M
 [123-219]  9.50000000000001e-28 G3DSA:2.40.110.10
G3DSA:2.40.110.10   Acyl_CoA_DH/ox_M
IPR006092 Acyl-CoA dehydrogenase, N-terminal (Domain)
 [7-118]  2.4e-20 PF02771
PF02771   Acyl-CoA_dh_N
IPR009075 Acyl-CoA dehydrogenase/oxidase C-terminal (Domain)
 [220-377]  5.19999999999996e-50 G3DSA:1.20.140.10
G3DSA:1.20.140.10   AcylCoA_DH_1/2_C
 [227-377]  1.79999754022375e-43 SSF47203
SSF47203   AcylCoADH_C_like
IPR009100 Acyl-CoA dehydrogenase/oxidase (Domain)
 [1-227]  8.00002659346736e-60 SSF56645
SSF56645   AcylCoA_dehyd_NM
IPR013786 Acyl-CoA dehydrogenase/oxidase, N-terminal (Domain)
 [1-120]  1.8e-24 G3DSA:1.10.540.10
G3DSA:1.10.540.10   AcylCoA_DH/ox_N
SignalP No significant hit
TMHMM No significant hit