close all open/close all

CDS information : Pyrlo_00080


close this sectionLocation

Organism
StrainATCC 31673 (=NBRC 14294)
Entry namePyrrolomycin
Contig
Start / Stop / Direction9,376 / 10,788 / + [in whole cluster]
9,376 / 10,788 / + [in contig]
Location9376..10788 [in whole cluster]
9376..10788 [in contig]
TypeCDS
Length1,413 bp (470 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category1.4 Other
Productputative L-proline--PCP ligase
putative L-prolyl-PCP synthetase
Product (GenBank)amino acid adenyltransferase
Gene
Gene (GenBank)pyr8
EC number
Keyword
  • pyrrole ring moiety
Note
Note (GenBank)
Reference
ACC
PmId
[17158935] Cloning and characterization of the pyrrolomycin biosynthetic gene clusters from Actinosporangium vitaminophilum ATCC 31673 and Streptomyces sp. strain UC 11065. (Antimicrob Agents Chemother. , 2007)
Related Reference
ACC
Q9X3R4
NITE
Pyolu_00090
PmId
[11880032] Conversion of L-proline to pyrrolyl-2-carboxyl-S-PCP during undecylprodigiosin and pyoluteorin biosynthesis. (Chem Biol. , 2002)

close this sectionPKS/NRPS Module

0
A9..396

close this sectionSequence

selected fasta
>putative L-proline--PCP ligase [amino acid adenyltransferase]
MHSSEGPTTYRDLDRLADQYAAALLGRGVAPGDRVVIWSHKCTEAVAVMQAALRVGAIYI
PVTGSNPPARLTKIVANAEPALVVADEDAAFRAHKAGWDRAPLLSLDELRRKASEGARPK
PYENQPDEPAYILYTSGSTGDPKGVCISHRNSLAFVEWAAAEVAVGPQDRLSNHAPFNFD
LSVFDLYAAFRAGASVHLVPQEMAYAPEQLVQFMRDRGITVWYSVPSALSLMIREGGLLD
GPVPPALRACIFAGEPFAVHHVHALRKGWPQVRLLNWYGPTETNVCTWYEVTDADLERDR
PVPIGRACSGDTVMLDPDNGDEGEVVVSGPTVMLGYWGKEPHRGPYRTGDMARRNSDGDL
EYSGRRDHMVKVRGHRIELGEIEAAIASLDSVSDVSVLVVGSGLEAQLHAAVVSSQANRP
SLLTVKRACAERLPTYMIIDKLHILDDLPRTANGKTDRARLTAAAEAGEL
selected fasta
>putative L-proline--PCP ligase [amino acid adenyltransferase]
GTGCACAGCTCCGAGGGACCCACCACCTACCGCGACCTCGACCGCCTGGCGGACCAGTAC
GCCGCCGCCCTGCTGGGCCGCGGTGTGGCGCCCGGCGACCGGGTGGTGATCTGGAGCCAC
AAGTGCACCGAGGCGGTCGCCGTGATGCAGGCCGCACTGCGCGTCGGGGCCATCTACATA
CCGGTGACCGGCTCCAACCCGCCGGCCCGGCTGACCAAGATCGTGGCCAACGCGGAGCCG
GCCCTGGTCGTCGCCGACGAGGACGCGGCGTTCCGCGCGCACAAGGCCGGGTGGGACCGG
GCCCCGCTGCTCAGCCTGGACGAGCTGCGCCGCAAGGCCTCCGAGGGGGCCCGCCCCAAG
CCGTACGAGAACCAGCCGGACGAACCCGCGTACATCCTCTACACCTCCGGGTCCACCGGG
GACCCGAAGGGGGTGTGCATCAGCCACCGCAACTCCCTGGCGTTCGTGGAGTGGGCGGCG
GCCGAGGTCGCGGTCGGCCCGCAGGACCGGCTGTCCAACCACGCCCCGTTCAACTTCGAC
CTGTCGGTGTTCGACTTGTACGCCGCGTTCCGGGCCGGGGCCTCGGTGCACCTGGTGCCG
CAGGAGATGGCGTACGCCCCCGAGCAGTTGGTGCAGTTCATGCGGGACCGCGGGATCACC
GTGTGGTACTCGGTGCCGTCCGCGCTGAGCCTGATGATCCGTGAGGGCGGCCTGCTGGAC
GGGCCGGTGCCGCCGGCGCTGCGCGCCTGCATCTTCGCCGGCGAGCCGTTCGCCGTCCAC
CACGTGCACGCACTGCGCAAGGGCTGGCCGCAGGTCCGCCTGCTGAACTGGTACGGCCCC
ACCGAGACCAACGTCTGCACCTGGTACGAGGTGACCGATGCCGACCTGGAGCGCGACCGC
CCGGTGCCGATAGGGCGGGCCTGCTCTGGTGACACCGTCATGCTCGACCCGGACAACGGG
GACGAGGGCGAGGTCGTGGTGAGCGGCCCGACCGTCATGCTCGGCTACTGGGGCAAGGAA
CCGCACCGGGGTCCGTACCGCACGGGCGACATGGCCCGCCGGAACTCCGACGGGGACCTG
GAGTACTCGGGGCGGCGCGACCACATGGTCAAGGTGCGTGGACACCGGATCGAACTGGGC
GAGATCGAGGCGGCCATCGCCTCGCTGGACTCGGTGTCCGACGTGTCCGTACTGGTCGTC
GGCTCGGGGCTGGAGGCCCAGCTCCACGCGGCCGTCGTGTCCTCCCAGGCCAACCGTCCG
TCGTTGCTCACTGTCAAGCGCGCCTGCGCGGAAAGGCTGCCGACCTACATGATCATCGAC
AAGCTGCACATACTCGACGACCTGCCCAGGACAGCCAACGGCAAGACCGATCGCGCGCGG
CTCACCGCCGCCGCTGAGGCGGGTGAACTCTGA
[0] A9..396
[0] A25..1188

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000873 AMP-dependent synthetase/ligase (Domain)
 [9-397]  9.2000000000001e-97 PF00501
PF00501   AMP-binding
IPR010071 Amino acid adenylation domain (Domain)
 [9-396]  2.79999999999994e-98 TIGR01733
TIGR01733   AA-adenyl-dom
IPR020845 AMP-binding, conserved site (Conserved_site)
 [132-143]  PS00455
PS00455   AMP_BINDING
SignalP No significant hit
TMHMM No significant hit