close all open/close all

CDS information : Pyrlo_00090


close this sectionLocation

Organism
StrainATCC 31673 (=NBRC 14294)
Entry namePyrrolomycin
Contig
Start / Stop / Direction10,788 / 11,351 / + [in whole cluster]
10,788 / 11,351 / + [in contig]
Location10788..11351 [in whole cluster]
10788..11351 [in contig]
TypeCDS
Length564 bp (187 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.3 modification reduction
Productputative flavin reductase
Product (GenBank)flavin reductase
Gene
Gene (GenBank)pyr9
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[17158935] Cloning and characterization of the pyrrolomycin biosynthetic gene clusters from Actinosporangium vitaminophilum ATCC 31673 and Streptomyces sp. strain UC 11065. (Antimicrob Agents Chemother. , 2007)
Related Reference
ACC
Q02058
NITE
Actino_00230
PmId
[7615536] Identification of a flavin:NADH oxidoreductase involved in the biosynthesis of actinorhodin. Purification and characterization of the recombinant enzyme. (J Biol Chem. , 1995)
[18245777] Mechanism and regulation of the Two-component FMN-dependent monooxygenase ActVA-ActVB from Streptomyces coelicolor. (J Biol Chem. , 2008)
[19246012] Biosynthesis of actinorhodin and related antibiotics: discovery of alternative routes for quinone formation encoded in the act gene cluster. (Chem Biol. , 2009)
[22086671] Epoxyquinone formation catalyzed by a two-component flavin-dependent monooxygenase involved in biosynthesis of the antibiotic actinorhodin. (Chembiochem. , 2011)
Family/Domain
FD
IPR002563

close this sectionSequence

selected fasta
>putative flavin reductase [flavin reductase]
MTLQAHTLTAVPPDDFTEPLPSVDIQTFRFVMGSFASGVSVVTTIDKQDQPRGLTCSAIC
SVSLDPPLLLSSVSNHSGTLESILTTGKFAVNILGSQGQAVSQLFASGAEDKFERVSWEP
GPMTGSPVLQVTVAHAECELYNAVEAGDHTLLIGRLVSGSTEQDRMPLAYWRGSYGRLDQ
ETAPRAS
selected fasta
>putative flavin reductase [flavin reductase]
ATGACGCTCCAAGCACACACCCTGACCGCCGTTCCGCCCGACGACTTCACCGAACCCCTG
CCCTCGGTGGACATCCAGACGTTCCGCTTCGTCATGGGCTCCTTCGCCAGCGGCGTCTCC
GTGGTGACCACCATCGACAAGCAGGACCAGCCACGGGGACTGACCTGCTCGGCGATCTGC
AGTGTCTCCCTGGACCCGCCGCTGCTGCTGTCCAGTGTCAGCAACCACAGCGGCACCCTC
GAGTCGATCCTGACCACCGGCAAGTTCGCGGTGAACATCCTCGGCTCCCAGGGCCAGGCC
GTGTCCCAGTTGTTCGCCTCGGGTGCGGAGGACAAGTTCGAGCGGGTGAGCTGGGAGCCG
GGCCCGATGACCGGCAGCCCGGTGTTGCAGGTGACCGTGGCCCACGCGGAGTGCGAGCTG
TACAACGCCGTGGAGGCCGGTGACCACACACTGCTGATCGGCCGCCTGGTCAGCGGCAGC
ACCGAGCAGGACCGGATGCCGTTGGCCTACTGGCGCGGCTCCTACGGCCGGCTCGACCAG
GAGACCGCGCCGCGGGCGTCCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR002563 Flavin reductase-like, FMN-binding (Domain)
 [32-178]  3.7e-35 PF01613
PF01613   Flavin_Reduct
 [32-177]  7.79998304125571e-50 SM00903
SM00903   Flavin_Reduct
IPR009002 FMN-binding split barrel-related (Domain)
 [20-186]  1.60000240695997e-46 SSF50475
SSF50475   FMN_binding
IPR012349 FMN-binding split barrel (Domain)
 [28-181]  2.29999999999998e-51 G3DSA:2.30.110.10
G3DSA:2.30.110.10   PNPOx_FMN_bd
SignalP No significant hit
TMHMM No significant hit