close all open/close all

CDS information : Pyrlo_00100


close this sectionLocation

Organism
StrainATCC 31673 (=NBRC 14294)
Entry namePyrrolomycin
Contig
Start / Stop / Direction11,725 / 11,426 / - [in whole cluster]
11,725 / 11,426 / - [in contig]
Locationcomplement(11426..11725) [in whole cluster]
complement(11426..11725) [in contig]
TypeCDS
Length300 bp (99 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.1 general function
Productputative acyl carrier protein
Product (GenBank)acyl-carrier protein
Gene
Gene (GenBank)pyr10
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[17158935] Cloning and characterization of the pyrrolomycin biosynthetic gene clusters from Actinosporangium vitaminophilum ATCC 31673 and Streptomyces sp. strain UC 11065. (Antimicrob Agents Chemother. , 2007)
Family/Domain
FD
IPR009081

close this sectionSequence

selected fasta
>putative acyl carrier protein [acyl-carrier protein]
MLELAVTQRVILDWLVEQVAERLGIPPEEVPVDAYIDELEIDSADAVGLVTDLERWFGYQ
LDVKAVWRYPTILALSGYLAREYARGGPGARMKRNDSLL
selected fasta
>putative acyl carrier protein [acyl-carrier protein]
ATGCTTGAACTGGCGGTCACCCAGCGGGTGATCCTGGACTGGCTGGTGGAGCAGGTCGCC
GAGCGACTCGGAATACCCCCGGAAGAGGTCCCCGTGGACGCGTACATCGACGAGTTGGAG
ATCGACTCGGCCGACGCCGTGGGGCTCGTCACCGACCTGGAACGCTGGTTCGGCTACCAG
CTCGACGTCAAGGCCGTGTGGCGCTACCCCACGATCCTGGCGCTCTCCGGGTACCTGGCC
CGGGAGTACGCCCGCGGCGGTCCGGGTGCACGGATGAAGCGGAACGACTCCCTGCTGTAG

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR009081 Acyl carrier protein-like (Domain)
 [8-83]  1.5e-16 G3DSA:1.10.1200.10
G3DSA:1.10.1200.10   ACP_like
 [13-79]  1.2e-11 PF00550
PF00550   PP-binding
 [11-80]  PS50075
PS50075   ACP_DOMAIN
 [2-87]  5.00000909915354e-17 SSF47336
SSF47336   ACP_like
SignalP No significant hit
TMHMM No significant hit