close all open/close all

CDS information : Pyrlo_00110


close this sectionLocation

Organism
StrainATCC 31673 (=NBRC 14294)
Entry namePyrrolomycin
Contig
Start / Stop / Direction13,560 / 11,887 / - [in whole cluster]
13,560 / 11,887 / - [in contig]
Locationcomplement(11887..13560) [in whole cluster]
complement(11887..13560) [in contig]
TypeCDS
Length1,674 bp (557 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.4 hypothetical protein
Producthypothetical protein
Product (GenBank)halogenase
Gene
Gene (GenBank)pyr11
EC number
Keyword
Note
  • Similar to halogenases but no obvious NAD(P)H binding region.
Note (GenBank)
Reference
ACC
PmId
[17158935] Cloning and characterization of the pyrrolomycin biosynthetic gene clusters from Actinosporangium vitaminophilum ATCC 31673 and Streptomyces sp. strain UC 11065. (Antimicrob Agents Chemother. , 2007)

close this sectionSequence

selected fasta
>hypothetical protein [halogenase]
MKAIKSPEHDRRLARAADPAEKYDVAILGGSMAAGLLGAVLSRQGVRVLLVGAADDDSDP
AGETTVPYTAEVFLLLAKRFQVPEIAAFGLFTDLPPWVRSESGVKKSLGFLYHHPGRPQD
PHECVQFNVPNEHGEWHLYRRGVDRYTRELAAKYGAALAGADVFVSDAWVEEDEGRVRVS
DGTVYRARFLVDCVGPDSPLLVRNGGDDAEPRLRHTSRVYATQMRGVVPFEALVPPSRQD
KVTPWSEGTVHHLFDGGWVQLVDFGNHKESRNPTTSVTLSVDPERFPDLPEEPDKAFRQV
VERFPDLARQFENATPVRPWTVETRYQRTASTTHGERWFGLERTAARNDMFLARDATMAA
ESVHALASVLIPAVRRDNWSPAPFARVALFQEALGEFNDRLLHAARTACQDFRLWNAFSR
VWLLWQILADLSLKRARLDAESSGDWSVCEQYELGGIWFQCPRGLRELIDRSLETVDEVR
RGGLAAGAAADRIFAELRREPFVPPLYAFGDPGARVYRFTLPKRLQMLFWVKTKAPADFR
RLLTVDNVSGVTAASSR
selected fasta
>hypothetical protein [halogenase]
ATGAAAGCCATCAAGTCCCCCGAGCACGACCGGCGGCTCGCCAGGGCGGCCGACCCCGCC
GAGAAGTACGACGTCGCGATACTCGGCGGCTCCATGGCCGCCGGGCTGCTGGGAGCGGTG
CTGTCCCGGCAGGGAGTGCGGGTGCTGTTGGTCGGCGCGGCCGACGACGACAGTGACCCC
GCCGGGGAGACCACGGTCCCCTACACGGCCGAGGTCTTCCTCCTGTTGGCCAAGCGCTTC
CAGGTGCCGGAGATCGCGGCCTTCGGGTTGTTCACCGACCTCCCGCCCTGGGTCAGGAGC
GAGAGCGGGGTCAAGAAGAGCCTGGGCTTCCTCTACCACCACCCGGGACGTCCCCAGGAC
CCCCACGAGTGCGTCCAGTTCAACGTCCCCAACGAGCACGGCGAATGGCACCTGTACCGG
CGGGGCGTGGACCGTTACACCCGGGAGCTGGCCGCGAAGTACGGGGCCGCGCTCGCCGGT
GCGGACGTGTTCGTCTCCGACGCCTGGGTGGAGGAGGACGAGGGCCGGGTGCGGGTCAGC
GACGGCACCGTCTACCGGGCCCGGTTCCTGGTGGACTGCGTCGGTCCCGACTCGCCGCTG
CTGGTGCGCAACGGGGGGGACGACGCCGAGCCCCGGCTGCGGCACACCTCGCGGGTCTAC
GCCACCCAGATGCGGGGGGTCGTCCCGTTCGAGGCCCTGGTGCCGCCGAGCCGCCAGGAC
AAGGTCACCCCGTGGTCCGAGGGCACGGTGCACCACCTGTTCGACGGCGGCTGGGTCCAG
TTGGTGGACTTCGGCAACCACAAGGAGAGCCGCAACCCGACCACCAGCGTCACCCTCAGC
GTCGACCCGGAGCGCTTCCCCGACCTGCCCGAGGAGCCGGACAAGGCCTTCCGCCAGGTG
GTGGAGAGGTTCCCGGACCTCGCCAGGCAGTTCGAGAACGCCACGCCGGTGCGTCCCTGG
ACCGTGGAGACCCGCTACCAGCGCACCGCGAGCACCACCCACGGCGAGCGTTGGTTCGGC
CTGGAGCGCACGGCCGCCCGCAACGACATGTTCCTGGCCCGGGACGCGACCATGGCCGCC
GAGTCGGTGCACGCCCTGGCCTCGGTGCTGATCCCCGCGGTGCGCCGGGACAACTGGTCG
CCCGCTCCGTTCGCGCGCGTGGCCCTGTTCCAGGAAGCCCTCGGCGAGTTCAACGACCGG
CTGCTGCACGCCGCCAGGACCGCCTGCCAGGACTTCCGGCTGTGGAACGCCTTCTCCCGG
GTGTGGCTGCTGTGGCAGATCCTGGCCGACCTGTCGCTGAAGCGGGCCCGGCTGGACGCC
GAGTCCAGCGGGGACTGGTCGGTGTGCGAGCAGTACGAACTGGGCGGGATCTGGTTCCAG
TGCCCGCGGGGCCTGCGGGAGCTGATCGACCGCAGCCTGGAGACCGTGGACGAGGTGCGC
CGCGGGGGACTGGCGGCCGGGGCCGCGGCGGACCGCATCTTCGCGGAACTGCGCCGGGAG
CCGTTCGTGCCGCCGCTGTACGCGTTCGGGGACCCGGGCGCCCGCGTGTACCGGTTCACC
CTGCCCAAGCGGTTGCAGATGCTGTTCTGGGTGAAGACCAAGGCTCCCGCGGACTTCCGC
AGGCTGCTGACGGTGGACAACGTCAGCGGGGTGACGGCTGCCTCGAGCCGCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
No significant hit
SignalP
 [1-1]  Signal-anchor
Eukaryota   
 [1-16]  0.284 Signal
Bacteria, Gram-negative   
TMHMM No significant hit