close all open/close all

CDS information : Pyrlo_00120


close this sectionLocation

Organism
StrainATCC 31673 (=NBRC 14294)
Entry namePyrrolomycin
Contig
Start / Stop / Direction14,602 / 13,733 / - [in whole cluster]
14,602 / 13,733 / - [in contig]
Locationcomplement(13733..14602) [in whole cluster]
complement(13733..14602) [in contig]
TypeCDS
Length870 bp (289 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.4 hypothetical protein
Producthypothetical protein
Product (GenBank)hypothetical membrane protein
Gene
Gene (GenBank)pyr12
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[17158935] Cloning and characterization of the pyrrolomycin biosynthetic gene clusters from Actinosporangium vitaminophilum ATCC 31673 and Streptomyces sp. strain UC 11065. (Antimicrob Agents Chemother. , 2007)

close this sectionSequence

selected fasta
>hypothetical protein [hypothetical membrane protein]
MVIRARPDDIPVTHPASGEPDGAGTSRTPATPAPREHTCSTGTARQALRDRGHTHRGDDA
RRAPGPRRTRGGDVPMDQIVDRLLALPAWLTLILVFLLPALEAAAFPGVLLPSQSAVMAG
GVLAYHGSAPIGAVLVAAVLGAVVGPGVGYLVGQRCGALMVARVPEWLVKSADLARAEDL
LRRLGGAAVVAARFFVGLRTVVPVLSGTARLPYRRFLAWNALAGTIWGVGWGLAGFAAGD
TWQRIGESTGQVAGALLALALVALLVRALVRRRLDDHAGPSAHQPPAPH
selected fasta
>hypothetical protein [hypothetical membrane protein]
ATGGTGATCCGAGCACGTCCGGACGACATCCCCGTGACGCACCCCGCCAGCGGCGAGCCG
GACGGGGCGGGCACCTCTCGCACCCCAGCCACACCCGCACCACGCGAACACACCTGCAGC
ACAGGCACTGCGCGGCAGGCACTGCGCGACAGAGGTCATACGCACCGCGGAGACGATGCG
CGGCGGGCACCGGGCCCGCGGCGCACTCGGGGAGGCGATGTCCCGATGGACCAGATCGTC
GACCGTCTGCTGGCCCTACCGGCGTGGCTCACCCTGATCCTGGTCTTCCTGCTGCCCGCG
CTCGAGGCGGCAGCGTTCCCCGGCGTCCTGCTGCCCAGCCAGTCCGCGGTGATGGCCGGC
GGAGTCCTCGCCTACCACGGCAGCGCGCCGATCGGCGCGGTGCTGGTCGCCGCCGTGCTC
GGTGCGGTGGTCGGGCCGGGGGTCGGCTACCTGGTCGGCCAGCGGTGCGGGGCGCTGATG
GTCGCGCGGGTACCCGAGTGGCTGGTCAAGTCCGCGGACCTGGCCAGGGCCGAGGACCTG
CTGCGCCGCCTCGGTGGCGCCGCCGTGGTCGCTGCCCGTTTCTTCGTCGGCCTGCGCACC
GTGGTTCCGGTGCTCAGCGGCACCGCCCGACTGCCCTACCGACGGTTCCTGGCCTGGAAC
GCCCTCGCCGGCACGATATGGGGCGTGGGCTGGGGACTGGCGGGATTCGCCGCGGGGGAC
ACCTGGCAGCGGATCGGGGAGTCCACCGGGCAGGTGGCGGGAGCGCTGTTGGCGCTGGCG
CTGGTGGCGCTGCTGGTCCGTGCGCTGGTGCGGCGGCGGCTGGACGACCACGCCGGGCCC
TCCGCCCACCAGCCGCCCGCCCCGCACTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR015414 SNARE associated Golgi protein (Family)
 [111-235]  2.7e-14 PF09335
PF09335   SNARE_assoc
SignalP No significant hit
TMHMM
 [89-111]  Transmembrane (i-o) [131-153]  Transmembrane (o-i) [216-238]  Transmembrane (i-o) [248-270]  Transmembrane (o-i)
Transmembrane 4