close all open/close all

CDS information : Pyrlo_00140


close this sectionLocation

Organism
StrainATCC 31673 (=NBRC 14294)
Entry namePyrrolomycin
Contig
Start / Stop / Direction16,639 / 16,121 / - [in whole cluster]
16,639 / 16,121 / - [in contig]
Locationcomplement(16121..16639) [in whole cluster]
complement(16121..16639) [in contig]
TypeCDS
Length519 bp (172 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.4 hypothetical protein
Producthypothetical protein
Product (GenBank)hypothetical protein
Gene
Gene (GenBank)pyr14
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[17158935] Cloning and characterization of the pyrrolomycin biosynthetic gene clusters from Actinosporangium vitaminophilum ATCC 31673 and Streptomyces sp. strain UC 11065. (Antimicrob Agents Chemother. , 2007)
Related Reference
ACC
Q70DW6
NITE
Resis_00120
PmId
[18533655] Orchestration of discoid polyketide cyclization in the resistomycin pathway. (J Am Chem Soc. , 2008)

close this sectionSequence

selected fasta
>hypothetical protein [hypothetical protein]
MVDVRVWRHFRAVLLAPVLMAVVVPLAIWLTAGLRQVEVPAAGRWLALAVGGALVSAGVA
LFLWTNVLFDREGKGTLAIFDPPRRLVVRGPYRHVRNPMITSVIAVLFGEAVMTRSSWLM
LWSLTFLGVNMLFMPLFEEPGLVRRFGEDYMRYRANVPRWLPRVRPWSGPSD
selected fasta
>hypothetical protein [hypothetical protein]
GTGGTTGACGTGCGGGTGTGGCGACACTTCAGGGCGGTTCTGCTCGCGCCGGTGCTGATG
GCCGTGGTGGTGCCGTTGGCGATCTGGCTCACCGCGGGACTCCGGCAGGTGGAGGTTCCG
GCGGCGGGGCGCTGGTTGGCCCTGGCGGTGGGCGGTGCCCTGGTTTCCGCCGGGGTGGCC
CTCTTCCTGTGGACCAACGTCCTCTTCGACCGCGAGGGCAAGGGCACTTTGGCGATCTTC
GATCCGCCGCGGCGGCTCGTGGTGCGGGGGCCGTACCGTCACGTGCGCAACCCCATGATC
ACTTCGGTGATCGCCGTGCTGTTCGGCGAGGCCGTGATGACCCGGTCGTCGTGGTTGATG
TTGTGGAGTCTGACGTTCCTCGGGGTCAACATGCTCTTCATGCCGCTGTTTGAGGAGCCC
GGACTGGTCCGCCGTTTTGGTGAGGATTACATGCGATACCGAGCGAATGTTCCGCGATGG
CTGCCCCGAGTTCGGCCGTGGTCGGGGCCAAGTGACTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR007318 Phospholipid methyltransferase (Family)
 [48-150]  2.9e-16 PF04191
PF04191   PEMT
SignalP
 [1-41]  0.722 Signal
Bacteria, Gram-positive   
 [1-33]  0.728 Signal
Eukaryota   
TMHMM
 [12-31]  Transmembrane (i-o) [46-68]  Transmembrane (o-i) [118-137]  Transmembrane (i-o)
Transmembrane 3