close all open/close all

CDS information : Pyrlo_00150


close this sectionLocation

Organism
StrainATCC 31673 (=NBRC 14294)
Entry namePyrrolomycin
Contig
Start / Stop / Direction17,291 / 18,232 / + [in whole cluster]
17,291 / 18,232 / + [in contig]
Location17291..18232 [in whole cluster]
17291..18232 [in contig]
TypeCDS
Length942 bp (313 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.1 general function
Productputative oxidoreductase
Product (GenBank)oxidoreductase
Gene
Gene (GenBank)pyr15
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[17158935] Cloning and characterization of the pyrrolomycin biosynthetic gene clusters from Actinosporangium vitaminophilum ATCC 31673 and Streptomyces sp. strain UC 11065. (Antimicrob Agents Chemother. , 2007)
Family/Domain
FD
IPR002198

close this sectionSequence

selected fasta
>putative oxidoreductase [oxidoreductase]
MRPSAPDQGSVVITGASTGIGRACALHLAENGFQVFAGVRKEADGASLERDAKGSLRALL
LDVTDQEQIEAAAAEVSRSSGGKLRCLVNNAGIGIPAPTELVDLDLLRRQFEVNVFGQVA
VTQEFLPLLRAATGRIVNMGSIADRLTMPFAGPLNSSKHALASLNDALRFELRPWGIHVV
LIEPAAIRSAAADGVKEHGQRLVDGLSPRGRHLYEDALRSMLSAMSDKMGRIAAPPSTVA
KVVHRAITVDRPKTRYLVGKPARPLAAISKVASDRAFDMIKARIFDQPRGFGSRGADVPD
DLESVRRARRRAS
selected fasta
>putative oxidoreductase [oxidoreductase]
ATGCGCCCATCAGCGCCCGACCAGGGCAGTGTCGTCATCACCGGGGCGTCGACCGGCATC
GGCCGCGCCTGCGCCCTGCACCTCGCGGAGAACGGGTTCCAGGTGTTCGCCGGCGTCCGC
AAGGAGGCCGACGGCGCGTCCCTCGAGCGTGACGCCAAGGGGAGCCTGCGCGCGCTGCTC
CTGGACGTGACCGACCAGGAGCAGATCGAGGCCGCGGCGGCCGAGGTCTCCCGGAGCAGC
GGCGGGAAGCTGCGCTGCCTGGTGAACAACGCCGGGATCGGCATCCCCGCCCCGACCGAA
CTGGTGGACCTGGACCTGCTCCGCAGGCAGTTCGAGGTCAATGTCTTCGGACAGGTCGCG
GTCACCCAGGAGTTCCTGCCGCTGCTGCGGGCGGCGACCGGCCGCATCGTCAACATGGGT
TCGATCGCGGACCGGTTGACGATGCCGTTCGCCGGTCCGTTGAACTCCTCGAAGCACGCC
CTGGCGTCGCTCAACGACGCGCTCCGCTTCGAGCTGCGCCCCTGGGGCATCCACGTGGTG
CTCATCGAGCCCGCCGCCATCCGCAGTGCCGCGGCGGACGGCGTGAAGGAGCACGGGCAA
CGGCTCGTCGACGGACTGAGCCCCCGCGGTCGCCACCTCTACGAGGACGCGCTGCGCTCG
ATGCTGTCAGCGATGAGCGACAAGATGGGCAGGATCGCCGCTCCGCCGTCCACGGTCGCC
AAGGTGGTGCACCGGGCGATCACCGTCGACCGACCCAAGACCCGTTACCTGGTCGGCAAG
CCGGCGCGTCCACTGGCCGCCATCTCCAAGGTGGCCTCGGACCGGGCCTTCGACATGATC
AAGGCCCGGATCTTCGACCAGCCGCGCGGCTTCGGGAGCCGGGGCGCCGACGTACCGGAC
GACCTGGAGTCGGTCCGGCGGGCGAGGCGGCGGGCGTCCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR002198 Short-chain dehydrogenase/reductase SDR (Family)
 [82-93]  1e-05 PR00080 [134-142]  1e-05 PR00080 [154-173]  1e-05 PR00080
PR00080   SDRFAMILY
 [9-172]  1.4e-24 PF00106
PF00106   adh_short
IPR002347 Glucose/ribitol dehydrogenase (Family)
 [10-27]  2.49999811956465e-17 PR00081 [82-93]  2.49999811956465e-17 PR00081 [128-144]  2.49999811956465e-17 PR00081 [154-173]  2.49999811956465e-17 PR00081 [175-192]  2.49999811956465e-17 PR00081
PR00081   GDHRDH
IPR016040 NAD(P)-binding domain (Domain)
 [11-260]  1.40000000000001e-62 G3DSA:3.40.50.720
G3DSA:3.40.50.720   NAD(P)-bd
SignalP
 [1-25]  0.171 Signal
Bacteria, Gram-negative   
 [1-25]  0.244 Signal
Bacteria, Gram-positive   
TMHMM No significant hit