close all open/close all

CDS information : Pyrlo_00170


close this sectionLocation

Organism
StrainATCC 31673 (=NBRC 14294)
Entry namePyrrolomycin
Contig
Start / Stop / Direction20,429 / 22,087 / + [in whole cluster]
20,429 / 22,087 / + [in contig]
Location20429..22087 [in whole cluster]
20429..22087 [in contig]
TypeCDS
Length1,659 bp (552 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.4 other modification
Productputative halogenase
Product (GenBank)halogenase
Gene
Gene (GenBank)pyr17
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[17158935] Cloning and characterization of the pyrrolomycin biosynthetic gene clusters from Actinosporangium vitaminophilum ATCC 31673 and Streptomyces sp. strain UC 11065. (Antimicrob Agents Chemother. , 2007)
Related Reference
ACC
Q71ME2
PmId
[15321684] A novel halogenase gene from the pentachloropseudilin producer Actinoplanes sp. ATCC 33002 and detection of in vitro halogenase activity. (FEMS Microbiol Lett. , 2004)
ACC
Q9X3Q8
NITE
Pyolu_00010
PmId
[10094695] Characterization of the pyoluteorin biosynthetic gene cluster of Pseudomonas fluorescens Pf-5. (J Bacteriol. , 1999)
[16162666] Dichlorination of a pyrrolyl-S-carrier protein by FADH2-dependent halogenase PltA during pyoluteorin biosynthesis. (Proc Natl Acad Sci U S A. , 2005)

close this sectionSequence

selected fasta
>putative halogenase [halogenase]
MISKANRFDVAIIGAGMGGSMLGAALARNGVKVLLIDGGIHPRFAVGEATIPYTNVSQRI
IAARYNLPELTTLCTLEDCTKAIGPTFGTKTHFGFLRHEQGKPQNPRETNEFHTPGLLHE
AHHLYRQDVDAFVFHLAVRCGCTPLQNWRVADVDFDGSGASLHGEDGSEYRARYVVDASG
YRSPLAKKFNLRDEIPKYKHHSRSMFTHVAGITHTDDLWPDRKPEYVPPVPWYEGTVHHM
FNRGWGWVIGFDNTPLSRNPLCSIGLTVDPRVWPKDPSLSVQEDFDRITGLFPDIKRQYA
GVTPVREWVSTDRLQYSSKQTVGDRWCLLSHAAAFIDPLFSYGLANTGDAVNKLAWRLIR
ACKDDDFSAERFDHIEQWQQARFHYNDEIVNSGFTAFDHFELWKAVFRVWVWGNNYGTFR
ARAGLTKFEQDGNDQHLRDLEKGQYLGYDWPDHEGFKHLFDTMVRNIDAFEAGKITADDA
AEEMWAVLEEVNFMPKPFGFQDRSVHFMSPKPPVIAKTAVWLARHGDPTVRKMLLKSGRQ
AIKLRLTNRKIF
selected fasta
>putative halogenase [halogenase]
ATGATCTCGAAGGCCAACAGGTTCGACGTCGCCATCATAGGCGCCGGCATGGGCGGCTCG
ATGCTGGGCGCCGCTCTCGCCCGCAACGGCGTCAAGGTCCTGCTGATAGACGGCGGCATA
CACCCCCGGTTCGCCGTTGGTGAGGCGACGATCCCCTACACCAACGTCTCCCAGCGCATC
ATCGCCGCGCGGTACAACCTCCCCGAGCTGACCACCCTGTGCACCCTCGAGGACTGCACC
AAGGCGATCGGCCCGACGTTCGGCACCAAGACCCACTTCGGCTTCCTGCGGCACGAGCAG
GGCAAGCCGCAGAACCCGCGGGAGACCAACGAGTTCCACACCCCCGGGCTGCTGCACGAG
GCCCACCACCTGTACCGGCAGGACGTGGACGCCTTCGTGTTCCACCTGGCGGTGCGCTGC
GGGTGCACCCCGCTGCAGAACTGGCGCGTCGCCGACGTGGACTTCGACGGGTCGGGCGCG
AGCCTGCACGGCGAGGACGGCTCGGAGTACCGGGCGCGCTACGTGGTGGACGCCAGTGGC
TACCGTTCGCCCCTGGCGAAGAAGTTCAACCTGCGCGACGAGATCCCCAAGTACAAGCAC
CACTCGCGGTCGATGTTCACCCACGTCGCCGGGATCACGCACACCGACGACCTGTGGCCG
GACCGCAAGCCGGAGTACGTGCCGCCGGTTCCGTGGTACGAGGGCACCGTCCACCACATG
TTCAACCGTGGTTGGGGGTGGGTCATCGGGTTCGACAACACCCCGCTGTCCCGGAACCCG
CTGTGCTCCATCGGTCTGACCGTGGACCCGCGGGTGTGGCCCAAGGACCCCAGCCTCTCC
GTCCAGGAGGACTTCGACCGGATCACCGGGCTCTTCCCGGACATCAAGCGGCAGTACGCC
GGGGTCACCCCGGTCCGCGAATGGGTTTCCACGGACCGCCTCCAGTACTCCTCGAAGCAG
ACCGTCGGTGACCGCTGGTGCCTGCTGTCGCACGCCGCGGCCTTTATCGACCCGCTGTTC
TCGTACGGTCTGGCCAACACCGGCGACGCGGTGAACAAGCTGGCCTGGCGGCTCATCCGG
GCCTGCAAGGACGACGACTTCTCCGCGGAGCGCTTCGACCACATCGAGCAGTGGCAGCAG
GCCCGCTTCCACTACAACGACGAGATCGTCAACTCCGGTTTCACCGCGTTCGACCACTTC
GAGCTCTGGAAGGCCGTCTTCCGGGTCTGGGTGTGGGGCAACAACTACGGCACCTTCCGG
GCGCGGGCCGGGCTGACCAAGTTCGAGCAGGACGGCAACGACCAGCACCTGCGGGACCTG
GAGAAGGGCCAGTACCTGGGTTACGACTGGCCGGACCACGAGGGCTTCAAGCACCTGTTC
GACACCATGGTGCGGAACATCGACGCCTTCGAGGCCGGGAAGATCACCGCGGACGACGCG
GCCGAGGAGATGTGGGCGGTGCTGGAGGAGGTCAACTTCATGCCCAAGCCCTTCGGCTTC
CAGGACCGCTCGGTGCACTTCATGAGCCCCAAGCCGCCGGTCATCGCCAAGACCGCGGTC
TGGCTCGCCCGGCACGGTGACCCCACCGTCCGCAAGATGCTGCTCAAGAGCGGTCGGCAG
GCCATCAAGCTCCGGCTGACCAACCGCAAGATCTTCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR003042 Aromatic-ring hydroxylase-like (Domain)
 [9-31]  3.99999861686541e-08 PR00420 [171-186]  3.99999861686541e-08 PR00420
PR00420   RNGMNOXGNASE
IPR006905 Tryptophan halogenase (Family)
 [9-57]  7.4e-05 PF04820 [117-376]  1.7e-07 PF04820
PF04820   Trp_halogenase
SignalP
 [1-27]  0.97 Signal
Bacteria, Gram-negative   
 [1-27]  0.782 Signal
Bacteria, Gram-positive   
TMHMM No significant hit