close all open/close all

CDS information : Pyrlo_00180


close this sectionLocation

Organism
StrainATCC 31673 (=NBRC 14294)
Entry namePyrrolomycin
Contig
Start / Stop / Direction22,254 / 24,338 / + [in whole cluster]
22,254 / 24,338 / + [in contig]
Location22254..24338 [in whole cluster]
22254..24338 [in contig]
TypeCDS
Length2,085 bp (694 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.1 general function
Productputative assimilatory nitrate reductase catalytic subunit
Product (GenBank)assimilatory nitrate reductase catalytic subunit
Gene
Gene (GenBank)pyr18
EC number1.7.99.4
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[17158935] Cloning and characterization of the pyrrolomycin biosynthetic gene clusters from Actinosporangium vitaminophilum ATCC 31673 and Streptomyces sp. strain UC 11065. (Antimicrob Agents Chemother. , 2007)
Related Reference
ACC
Q9EYG2
PmId
[21424691] Identification and functional analysis of a nitrate assimilation operon nasACKBDEF from Amycolatopsis mediterranei U32. (Arch Microbiol. , 2011)

close this sectionSequence

selected fasta
>putative assimilatory nitrate reductase catalytic subunit [assimilatory nitrate reductase catalytic subunit]
MDTHCPYCALQCATTLTPGGPSGVTVAPRDFPTNRGGLCRKGWTAPAVLAAPDRLTTPLV
RSAGELRPTSWEHALDVVARGIADAQQKGGADAVGVFGGGGLTNEKAYLLGKFARVALGT
SQLDYNGRFCMSSAAAAGLRAFGLDRGLPFPLADLGGADVVLLAGANPAETMPPLLAHLT
TAQLVVVDPRRSATAQLAVDRGGMHLQPAPGTDLAVALGLLHVVFTEGWWDRDYVLERTR
GVEEVRQAAAAWWPERVERVTGVGVGDLRRAAAALGAARRDGAGVYVLTGRGVEQHANGT
ATTSAFINLALALGLPGNPGRGYGCLTGQGNGQGGREHGQKSDQLPGYRRIDDPAARAHV
AEVWGVPADSLPGPGRTAYELLDALGTPAGPRALLVFGSNPVVSAPRAAHVEERLSALDL
LVVADVVPSETARLADVVLPVTQWAEEDGTMTNLEGRVLRRRRAVPPPDGVRSDLEVLRG
LAERLGQPAERFPTDPSEVYDELRAASAGGVADYRGIEWARLDAGEALYWPCPDRTHPGT
PRMFTERFAHPDGLARFVPVEFTPPDATSADYPLYATVGRTLAQYQSGAQTRRVPELTAA
EPGTYVEVHPDTAALAGLADGDLARVVARNGATRATVRTDARMRQDTVFLPFHFPGEERA
NLLTDPRLDPVSRMPELKLCPVRLEPLAGERTTS
selected fasta
>putative assimilatory nitrate reductase catalytic subunit [assimilatory nitrate reductase catalytic subunit]
GTGGACACGCACTGCCCGTACTGCGCCCTCCAGTGCGCCACTACCCTGACCCCCGGTGGC
CCGTCCGGCGTGACGGTCGCCCCCCGGGACTTCCCCACCAACCGCGGCGGCCTGTGCCGC
AAGGGGTGGACGGCCCCCGCGGTGCTCGCCGCCCCCGACCGACTCACGACCCCGCTGGTG
CGCAGCGCCGGGGAGCTCCGCCCGACGAGTTGGGAGCACGCCCTGGACGTGGTGGCCCGC
GGGATCGCGGACGCCCAGCAGAAAGGGGGCGCGGACGCCGTCGGGGTGTTCGGCGGGGGT
GGCCTCACCAACGAGAAGGCGTACCTGCTGGGGAAGTTCGCCCGGGTGGCGCTCGGCACC
TCCCAACTGGACTACAACGGGCGGTTCTGCATGTCCTCGGCCGCGGCTGCCGGCCTCCGG
GCGTTCGGCCTCGACCGCGGGCTCCCGTTCCCCCTGGCCGACCTCGGCGGGGCCGACGTG
GTCCTGCTCGCCGGGGCCAACCCGGCCGAGACCATGCCTCCGCTGCTCGCGCACCTGACC
ACCGCCCAACTCGTGGTCGTCGATCCGCGCCGCTCGGCCACCGCCCAACTGGCCGTTGAC
CGCGGGGGAATGCACCTGCAGCCCGCCCCGGGGACCGACCTGGCGGTGGCCCTGGGCCTG
CTCCACGTGGTGTTCACCGAGGGCTGGTGGGACCGGGACTACGTCCTCGAGCGCACCCGT
GGCGTGGAGGAGGTCCGGCAGGCCGCCGCCGCCTGGTGGCCCGAGCGGGTGGAACGCGTC
ACCGGTGTCGGCGTCGGCGATCTGCGCAGGGCCGCGGCCGCCCTGGGGGCGGCCCGGCGC
GACGGGGCGGGCGTCTACGTGCTCACCGGCCGGGGGGTGGAGCAGCACGCCAACGGTACG
GCGACGACCAGCGCGTTCATCAACCTGGCGCTGGCACTGGGCCTGCCCGGGAACCCGGGT
CGCGGCTACGGCTGTCTGACCGGCCAGGGCAACGGCCAGGGCGGAAGGGAGCACGGCCAG
AAGTCCGACCAGCTCCCCGGCTACCGCAGGATCGACGACCCGGCCGCCAGGGCGCACGTC
GCCGAGGTGTGGGGTGTTCCCGCCGACTCCCTGCCCGGCCCAGGACGCACCGCCTACGAG
CTCCTCGACGCGCTCGGCACACCGGCGGGACCGCGTGCCCTGCTGGTGTTCGGCTCGAAC
CCGGTGGTGTCCGCGCCGCGCGCCGCCCACGTCGAGGAACGCCTCTCCGCGCTGGACCTG
CTGGTGGTCGCCGACGTGGTGCCCTCGGAGACGGCCCGGCTCGCGGACGTGGTGCTCCCG
GTCACCCAGTGGGCCGAGGAGGACGGCACCATGACCAACCTGGAGGGCAGGGTGCTGCGG
CGCCGGCGGGCGGTGCCCCCGCCGGACGGGGTCCGTTCGGACCTGGAGGTGCTGCGCGGC
CTCGCGGAGCGCCTCGGGCAGCCGGCGGAACGGTTCCCCACCGACCCTTCCGAGGTCTAC
GACGAACTGCGCGCGGCCTCCGCGGGCGGGGTGGCGGACTACCGGGGCATCGAGTGGGCC
CGCCTCGACGCCGGTGAGGCGCTGTACTGGCCGTGCCCGGACCGCACCCACCCCGGGACG
CCGCGGATGTTCACCGAGCGGTTCGCGCACCCCGACGGCCTCGCGCGCTTCGTCCCCGTG
GAGTTCACCCCGCCGGACGCCACCTCGGCGGACTACCCGCTGTACGCGACGGTCGGCCGC
ACCCTGGCCCAGTACCAGTCGGGGGCGCAGACCCGCCGGGTGCCGGAGCTGACCGCCGCG
GAGCCCGGCACCTACGTCGAGGTGCACCCGGACACCGCGGCCCTGGCCGGTCTCGCGGAC
GGGGACCTGGCCCGGGTGGTGGCGCGGAACGGCGCGACCCGGGCGACCGTGCGCACCGAC
GCCCGGATGCGGCAGGACACGGTGTTCCTGCCGTTCCACTTCCCGGGTGAGGAGCGGGCG
AACCTGCTCACCGACCCCAGGCTCGACCCCGTCTCCCGCATGCCGGAGCTGAAGCTGTGC
CCGGTGCGCCTCGAGCCCCTGGCCGGGGAGCGAACGACGTCGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR006656 Molybdopterin oxidoreductase (Domain)
 [54-484]  1.9e-63 PF00384
PF00384   Molybdopterin
IPR006657 Molydopterin dinucleotide-binding domain (Domain)
 [574-681]  7.90000000000001e-27 PF01568
PF01568   Molydop_binding
IPR006963 Molybdopterin oxidoreductase, Fe4S4 domain (Domain)
 [2-45]  2e-07 PF04879
PF04879   Molybdop_Fe4S4
 [1-51]  3.1999989904635e-05 SM00926
SM00926   Molybdop_Fe4S4
IPR009010 Aspartate decarboxylase-like fold (Domain)
 [573-686]  2.5e-30 G3DSA:2.40.40.20
G3DSA:2.40.40.20   Asp_decarboxylase-like_fold
 [536-686]  3.29999077503323e-41 SSF50692
SSF50692   Asp_decarb_fold
SignalP No significant hit
TMHMM No significant hit