close all open/close all

CDS information : Pyrlo_00190


close this sectionLocation

Organism
StrainATCC 31673 (=NBRC 14294)
Entry namePyrrolomycin
Contig
Start / Stop / Direction24,575 / 25,996 / + [in whole cluster]
24,575 / 25,996 / + [in contig]
Location24575..25996 [in whole cluster]
24575..25996 [in contig]
TypeCDS
Length1,422 bp (473 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.1 general function
Productputative assimilatory nitrate reductase electron transfer subunit
Product (GenBank)assimilatory nitrate reductase electron transfer subunit
Gene
Gene (GenBank)pyr19
EC number
Keyword
Note
  • This ORF product lacks the BFD-like [2Fe-2S]-binding domain (IPR007419) in the C-terminal region.
Note (GenBank)
Reference
ACC
PmId
[17158935] Cloning and characterization of the pyrrolomycin biosynthetic gene clusters from Actinosporangium vitaminophilum ATCC 31673 and Streptomyces sp. strain UC 11065. (Antimicrob Agents Chemother. , 2007)
Related Reference
ACC
Q9EYG1
PmId
[21424691] Identification and functional analysis of a nitrate assimilation operon nasACKBDEF from Amycolatopsis mediterranei U32. (Arch Microbiol. , 2011)

close this sectionSequence

selected fasta
>putative assimilatory nitrate reductase electron transfer subunit [assimilatory nitrate reductase electron transfer subunit]
MVIVGNGMAGHRLAQELRARRPEVRVTLVGEEPRPAYNRVLLSTVLAGTVSADALELADC
GARMRLGVRALELDTERRRVTLSDGSVLGYETLVLATGARPVLPRVPGLAADDGGPAPGV
STFRTLADCTLISRLALGGSMAVLGGGLLGVEAARGLAGLGVDVTLVHPVGHLMENQLDP
EAGEVLARMLRDLGVRVLLGVGASRWQPSPDEGELVLSDGRAVRCGGVVVTAGVAPVTEL
ARSAGLAVGRGVVVDDRLRTSAPGVYAIGECAEHRGVCHGLVGPCWEQAAVLADVLVGKD
TEYTGSRPVVRLKARDVDLAAMGRVPAEPDGDTELVRVSDVTRGRYGVLALRAERLVGAI
LLGLPDATGPVTQLHDSGSPAPADRFGLLLGTGAAVSETPDKLPERALVCRCNGVTKARL
VEAWHAGARDPEALSVLHLGHHRLRQLFGHRAAAVHLAGARGRLTVHGRPGRP
selected fasta
>putative assimilatory nitrate reductase electron transfer subunit [assimilatory nitrate reductase electron transfer subunit]
GTGGTCATCGTCGGCAACGGCATGGCCGGGCACCGGCTCGCCCAGGAGCTGCGCGCCCGG
CGCCCGGAGGTGCGGGTCACCCTGGTGGGCGAGGAGCCGCGCCCCGCCTACAACCGGGTG
CTGCTGTCCACCGTCCTCGCCGGCACCGTGTCCGCGGACGCCCTGGAGCTCGCCGACTGC
GGTGCCCGGATGCGCCTGGGCGTGCGGGCGCTCGAGCTCGACACGGAGCGCCGCCGGGTC
ACCCTCTCCGACGGGTCGGTCCTCGGCTACGAGACGCTGGTGCTGGCCACGGGGGCGCGC
CCGGTGCTGCCCCGGGTGCCGGGGCTCGCCGCCGACGACGGCGGACCCGCGCCCGGGGTG
AGCACCTTCCGCACCCTGGCGGACTGCACGCTCATCTCCCGCCTCGCCCTGGGCGGGTCC
ATGGCCGTGCTCGGGGGCGGGCTGCTCGGGGTGGAGGCGGCCCGGGGCCTGGCCGGGCTG
GGGGTGGACGTCACCCTGGTGCACCCGGTGGGTCACCTGATGGAGAACCAGCTCGACCCC
GAGGCCGGGGAGGTCCTCGCCCGGATGCTGCGTGACCTGGGCGTGCGGGTGCTGCTCGGC
GTGGGTGCCAGCCGTTGGCAGCCGTCGCCGGACGAGGGCGAACTCGTCCTGTCCGACGGC
CGGGCGGTGCGGTGCGGCGGGGTCGTGGTGACCGCGGGGGTGGCCCCGGTGACCGAGCTG
GCCCGCTCGGCGGGGCTGGCCGTGGGACGGGGCGTCGTGGTGGACGACCGGCTGCGGACC
TCCGCGCCCGGGGTGTACGCGATCGGCGAGTGCGCCGAGCACCGGGGTGTGTGCCACGGT
CTGGTGGGGCCGTGCTGGGAGCAGGCCGCCGTCCTCGCCGACGTGCTCGTCGGCAAGGAC
ACCGAGTACACCGGGTCCCGTCCGGTGGTGCGGCTCAAGGCCCGCGACGTGGACCTGGCC
GCGATGGGTCGTGTCCCCGCGGAGCCGGACGGGGACACCGAGCTGGTGCGGGTGTCCGAT
GTCACCCGAGGCCGCTACGGCGTTCTCGCGCTGCGCGCCGAACGTCTCGTCGGGGCGATC
CTGCTCGGGCTGCCGGACGCCACCGGGCCGGTCACCCAGCTCCATGACTCCGGGTCGCCG
GCACCCGCCGACCGCTTCGGGTTGCTGCTCGGGACCGGGGCCGCGGTCAGCGAGACGCCG
GACAAGCTGCCGGAACGGGCGCTGGTGTGCCGGTGCAACGGGGTGACCAAGGCCCGGCTC
GTCGAGGCCTGGCACGCCGGTGCCCGCGACCCCGAGGCGCTGTCCGTCCTCCACCTGGGC
CACCACCGGCTGCGGCAGTTGTTCGGACACCGTGCAGCGGCTGTGCACCTGGCTGGCGCG
CGAGGCCGTCTGACCGTCCATGGCCGCCCCGGGCGGCCGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001327 Pyridine nucleotide-disulphide oxidoreductase, NAD-binding domain (Domain)
 [140-212]  2e-14 PF00070
PF00070   Pyr_redox
IPR013027 FAD-dependent pyridine nucleotide-disulphide oxidoreductase (Family)
 [1-14]  9.19998414420358e-24 PR00368 [90-108]  9.19998414420358e-24 PR00368 [140-158]  9.19998414420358e-24 PR00368 [225-241]  9.19998414420358e-24 PR00368 [250-272]  9.19998414420358e-24 PR00368
PR00368   FADPNR
IPR023753 Pyridine nucleotide-disulphide oxidoreductase, FAD/NAD(P)-binding domain (Domain)
 [2-114]  4.00000000000001e-13 PF07992 [231-274]  9.9e-07 PF07992
PF07992   Pyr_redox_2
SignalP
 [1-38]  0.04 Signal
Bacteria, Gram-negative   
TMHMM No significant hit