close all open/close all

CDS information : Pyrlo_00200


close this sectionLocation

Organism
StrainATCC 31673 (=NBRC 14294)
Entry namePyrrolomycin
Contig
Start / Stop / Direction26,400 / 27,617 / + [in whole cluster]
26,400 / 27,617 / + [in contig]
Location26400..27617 [in whole cluster]
26400..27617 [in contig]
TypeCDS
Length1,218 bp (405 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.3 modification reduction
Productputative cytochrome P450
Product (GenBank)cytochrome P450
Gene
Gene (GenBank)pyr20
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[17158935] Cloning and characterization of the pyrrolomycin biosynthetic gene clusters from Actinosporangium vitaminophilum ATCC 31673 and Streptomyces sp. strain UC 11065. (Antimicrob Agents Chemother. , 2007)
Related Reference
ACC
P33271
PmId
[1732208] Characterization of Saccharopolyspora erythraea cytochrome P-450 genes and enzymes, including 6-deoxyerythronolide B hydroxylase. (J Bacteriol. , 1992)
ACC
Q9KHJ7
NITE
Enter_00180
PmId
[11137817] Cloning, sequencing and analysis of the enterocin biosynthesis gene cluster from the marine isolate 'Streptomyces maritimus': evidence for the derailment of an aromatic polyketide synthase. (Chem Biol. , 2000)
[17704772] Enzymatic total synthesis of enterocin polyketides. (Nat Chem Biol. , 2007)

close this sectionSequence

selected fasta
>putative cytochrome P450 [cytochrome P450]
MVEKMDQHQGAISFPFPARSHLEFPPQFAEAHAKCPVSRVKLPHGQEAWLATGHDVVRKV
LVDPNFSRALAAEHENRRLTPAAILNSSLIGLDPPDHTRLRTLASRAFTARRVERLRPHI
VAIIDDLLTAMGKHEGPVDLLEHFMRPLPALVISEMMGVPEQDIERFLEWSAEAIAGPSN
PEAAAAGYQSLIEFFGKLIEDKRRAPGDDLLSALIAAHDEQDKLSDDEMVALSVLLLVAG
HEAITTVFSWFVIILTTQYPEHWKHLQSHPEDIAPTVEELLRVVPRTKIGGGFPRIARED
TELAGVRIKAGEAVIPAMDAANRDPVVYGEDPERLDFNRSENPHLGFGAGVHFCIGAPLA
RLQMQEGMRLLLKHFPTLRVAVPVEELKLTPETAMRILLSVPVTW
selected fasta
>putative cytochrome P450 [cytochrome P450]
ATGGTGGAGAAGATGGACCAACACCAAGGCGCGATCTCCTTCCCCTTCCCGGCACGCAGT
CACCTCGAGTTCCCCCCGCAGTTCGCGGAGGCACACGCCAAGTGCCCGGTCAGCCGGGTC
AAGCTCCCGCACGGCCAGGAGGCGTGGCTGGCCACAGGACACGACGTGGTGCGCAAGGTC
CTCGTCGATCCCAACTTCAGTCGGGCCCTCGCAGCCGAGCACGAGAACCGGCGACTCACG
CCGGCTGCGATCCTGAACTCCTCCCTGATCGGGCTCGACCCGCCCGACCACACCCGGCTC
CGCACCCTGGCCAGCCGCGCCTTCACCGCCCGCAGGGTGGAGCGGCTGCGTCCGCACATC
GTCGCCATCATCGACGACCTGCTGACCGCGATGGGGAAGCACGAGGGCCCCGTCGATCTG
CTCGAGCACTTCATGCGGCCCCTGCCCGCGCTGGTCATCAGCGAGATGATGGGCGTTCCC
GAGCAGGACATCGAGCGGTTCCTGGAGTGGTCCGCCGAGGCCATCGCCGGGCCGAGCAAC
CCGGAGGCGGCCGCGGCCGGTTACCAGAGCCTGATCGAGTTCTTCGGGAAGCTCATCGAG
GACAAGCGGAGGGCCCCCGGGGACGACCTGCTCAGCGCACTGATCGCGGCCCACGACGAA
CAGGACAAGCTCAGCGACGACGAGATGGTGGCGCTCAGCGTGCTGCTGCTCGTCGCCGGG
CACGAGGCCATCACCACGGTCTTCAGTTGGTTCGTCATCATCCTGACCACCCAGTACCCC
GAGCACTGGAAGCACCTCCAGAGCCACCCCGAGGACATCGCGCCCACGGTGGAGGAACTG
TTGCGGGTGGTTCCCCGAACCAAGATCGGGGGCGGTTTCCCACGGATCGCCAGGGAGGAC
ACCGAGCTGGCGGGGGTGCGGATCAAGGCCGGGGAGGCGGTGATCCCGGCGATGGACGCG
GCGAACCGGGACCCGGTGGTCTACGGCGAGGACCCGGAGCGCCTGGACTTCAACCGCTCG
GAGAACCCGCACCTCGGGTTCGGCGCGGGGGTGCACTTCTGCATCGGCGCCCCGCTCGCA
AGGCTCCAGATGCAGGAGGGCATGCGACTGCTGTTGAAGCACTTCCCCACCCTGCGGGTG
GCGGTTCCGGTCGAGGAACTCAAGCTCACCCCGGAGACGGCGATGCGCATCCTGCTGAGC
GTCCCGGTGACCTGGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001128 Cytochrome P450 (Family)
 [239-256]  2.19999900980708e-06 PR00385 [275-286]  2.19999900980708e-06 PR00385 [345-354]  2.19999900980708e-06 PR00385 [354-365]  2.19999900980708e-06 PR00385
PR00385   P450
 [4-405]  3.60002015031011e-91 SSF48264
SSF48264   Cytochrome_P450
 [17-405]  2.70000000000002e-101 G3DSA:1.10.630.10
G3DSA:1.10.630.10   Cyt_P450
 [201-267]  2.9e-05 PF00067 [276-376]  1.8e-15 PF00067
PF00067   p450
IPR002397 Cytochrome P450, B-class (Family)
 [92-103]  5.50001754266469e-50 PR00359 [139-155]  5.50001754266469e-50 PR00359 [156-171]  5.50001754266469e-50 PR00359 [193-215]  5.50001754266469e-50 PR00359 [275-286]  5.50001754266469e-50 PR00359 [295-322]  5.50001754266469e-50 PR00359 [345-354]  5.50001754266469e-50 PR00359 [354-365]  5.50001754266469e-50 PR00359
PR00359   BP450
IPR017972 Cytochrome P450, conserved site (Conserved_site)
 [347-356]  PS00086
PS00086   CYTOCHROME_P450
SignalP
 [1-31]  0.208 Signal
Bacteria, Gram-positive   
TMHMM No significant hit