close all open/close all

CDS information : Pyrlo_00210


close this sectionLocation

Organism
StrainATCC 31673 (=NBRC 14294)
Entry namePyrrolomycin
Contig
Start / Stop / Direction27,983 / 28,297 / + [in whole cluster]
27,983 / 28,297 / + [in contig]
Location27983..28297 [in whole cluster]
27983..28297 [in contig]
TypeCDS
Length315 bp (104 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.3 modification reduction
Productputative monooxygenase
Product (GenBank)monooxygenase
Gene
Gene (GenBank)pyr21
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[17158935] Cloning and characterization of the pyrrolomycin biosynthetic gene clusters from Actinosporangium vitaminophilum ATCC 31673 and Streptomyces sp. strain UC 11065. (Antimicrob Agents Chemother. , 2007)
Related Reference
ACC
Q9L4Y0
NITE
Ello_00080
PmId
[11325225] Cloning, sequencing, and heterologous expression of the elmGHIJ genes involved in the biosynthesis of the polyketide antibiotic elloramycin from Streptomyces olivaceus Tu2353. (J Nat Prod. , 2001)

close this sectionSequence

selected fasta
>putative monooxygenase [monooxygenase]
MTANPTDVITLVNVYSVEPERQDELVDLLYRTADELMRHQPGFITAHIYRSMDGTRVTNY
AQWRSMADFQAVQQLPEAAKYVKASAELGASDPHVYTVASVHTA
selected fasta
>putative monooxygenase [monooxygenase]
ATGACAGCGAACCCCACCGATGTCATCACCCTGGTCAACGTCTACTCGGTCGAGCCGGAG
CGTCAGGACGAGCTGGTCGACCTGCTGTACCGCACCGCTGACGAACTGATGCGGCACCAG
CCCGGCTTCATCACCGCCCACATCTACCGCAGCATGGACGGCACCCGGGTGACCAACTAC
GCGCAGTGGCGGTCAATGGCCGACTTCCAGGCCGTGCAGCAGCTCCCCGAGGCGGCGAAG
TACGTGAAGGCGTCCGCCGAGCTCGGTGCGTCCGACCCCCACGTCTACACCGTGGCGTCG
GTCCACACCGCCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR007138 Antibiotic biosynthesis monooxygenase (Domain)
 [9-83]  5.69999999999998e-19 PF03992
PF03992   ABM
IPR011008 Dimeric alpha-beta barrel (Domain)
 [8-102]  7.30000590915208e-24 SSF54909
SSF54909   Dimer_A_B_barrel
SignalP No significant hit
TMHMM No significant hit