close all open/close all

CDS information : Pyrlo_00220


close this sectionLocation

Organism
StrainATCC 31673 (=NBRC 14294)
Entry namePyrrolomycin
Contig
Start / Stop / Direction29,323 / 28,625 / - [in whole cluster]
29,323 / 28,625 / - [in contig]
Locationcomplement(28625..29323) [in whole cluster]
complement(28625..29323) [in contig]
TypeCDS
Length699 bp (232 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.2 modification methylation
Productputative methyltransferase
Product (GenBank)methyl transferase
Gene
Gene (GenBank)pyr22
EC number2.1.1.-
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[17158935] Cloning and characterization of the pyrrolomycin biosynthetic gene clusters from Actinosporangium vitaminophilum ATCC 31673 and Streptomyces sp. strain UC 11065. (Antimicrob Agents Chemother. , 2007)
Family/Domain
FD
IPR013216

close this sectionSequence

selected fasta
>putative methyltransferase [methyl transferase]
MNETNAFFQAVYRHDSEFGNQSPPWDIDGPQPVFVDLANSGKISGEVLDAGFGPAGLSLY
LATEGYAVTGIDQSPEAVDAARARARQRGLRASFAVGDLLDLSEYRGRFGTVVECGVFHG
LGPDERRQYARSLHVATRPGAHAHLLNLTGSGQEAARARLAESGMSAPAVEGFHAVTAEH
LRAAFAGLWDVVSIEERAMKLRFPGDQQFTELPAVLSTFKRRPDVRCTGAAK
selected fasta
>putative methyltransferase [methyl transferase]
ATGAACGAGACCAACGCCTTCTTCCAGGCTGTCTACCGTCATGACTCCGAATTCGGAAAC
CAGAGTCCGCCCTGGGACATCGACGGTCCGCAGCCGGTCTTCGTCGATCTCGCCAATTCG
GGAAAGATCAGCGGTGAGGTGCTCGACGCCGGTTTCGGACCCGCGGGACTGAGCCTGTAC
CTGGCCACCGAGGGCTACGCGGTCACCGGGATCGACCAGTCGCCCGAGGCGGTTGACGCG
GCCCGGGCGCGGGCACGCCAGCGCGGCCTGCGCGCGTCGTTCGCCGTTGGGGACCTGCTG
GACCTCTCGGAGTACCGCGGGCGCTTCGGCACGGTCGTGGAGTGTGGCGTCTTCCACGGC
CTCGGCCCCGACGAGCGCCGGCAGTACGCCCGATCACTGCACGTGGCGACCAGGCCAGGG
GCCCACGCCCACCTGCTCAACCTGACCGGCAGCGGCCAGGAGGCCGCCCGGGCCCGCCTC
GCCGAGTCGGGGATGTCCGCGCCGGCGGTGGAGGGGTTCCACGCCGTGACCGCGGAACAC
CTGCGAGCCGCTTTCGCCGGACTCTGGGACGTGGTGTCGATCGAGGAACGAGCCATGAAA
CTCAGGTTCCCGGGCGACCAGCAATTCACCGAACTTCCCGCCGTGTTGTCCACGTTCAAA
AGGCGGCCCGACGTTCGGTGTACGGGGGCCGCGAAATAA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR013216 Methyltransferase type 11 (Domain)
 [48-142]  1.2e-09 PF08241
PF08241   Methyltransf_11
SignalP No significant hit
TMHMM No significant hit