close all open/close all

CDS information : Pyrlo_00230


close this sectionLocation

Organism
StrainATCC 31673 (=NBRC 14294)
Entry namePyrrolomycin
Contig
Start / Stop / Direction30,675 / 29,608 / - [in whole cluster]
30,675 / 29,608 / - [in contig]
Locationcomplement(29608..30675) [in whole cluster]
complement(29608..30675) [in contig]
TypeCDS
Length1,068 bp (355 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.4 hypothetical protein
Producthypothetical protein
Product (GenBank)putative membrane protein
Gene
Gene (GenBank)pyr23
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[17158935] Cloning and characterization of the pyrrolomycin biosynthetic gene clusters from Actinosporangium vitaminophilum ATCC 31673 and Streptomyces sp. strain UC 11065. (Antimicrob Agents Chemother. , 2007)

close this sectionSequence

selected fasta
>hypothetical protein [putative membrane protein]
MGHHVDGGDGAPGPATPQQLAKRVGPPVLGSVVFLALFIWIVGVSMHTPKPHDAPFGLVG
DRAAVQPLEQQLEGAGSAFDVKVYPTAEAAREAVIDQDVLGAFVPGTDKAELMVATGIGQ
TPKMFYTGFFNEMAHQQGFELVTNDVAPVPQGDLLGLVAFFVFASLTVASVLCQVLFSFL
ARGVPFRVWFGAAVAFGLLAGTTVCLFADPVLGALDGHFLQITTLTCLYGFVIVASMAAF
QALLGLPGIPLGALTLLPFGIGTSGGTVHPDFLPNFYRQISPYMASSAEVGGLRGIAYMD
GSGVGRSFLVLGIWAVVALLLVGLGGMLKARRAGGAASADPSGRKNGRVAAPSAV
selected fasta
>hypothetical protein [putative membrane protein]
ATGGGACACCATGTCGATGGTGGCGACGGGGCGCCCGGCCCTGCCACTCCCCAGCAGCTC
GCCAAACGCGTGGGGCCGCCGGTTCTCGGTAGCGTGGTTTTCCTCGCGCTGTTCATATGG
ATCGTCGGCGTCTCCATGCACACCCCCAAACCGCATGACGCCCCGTTCGGGCTCGTGGGC
GACCGCGCTGCGGTCCAGCCGTTGGAGCAGCAGCTCGAAGGCGCGGGTTCCGCGTTCGAC
GTGAAGGTCTACCCGACCGCCGAGGCGGCCCGCGAGGCCGTGATCGACCAGGACGTCCTG
GGTGCCTTCGTGCCCGGCACGGACAAGGCCGAGCTCATGGTGGCGACTGGTATCGGCCAG
ACGCCCAAGATGTTCTACACCGGGTTCTTCAACGAGATGGCGCACCAGCAGGGCTTCGAG
CTGGTGACCAACGACGTGGCTCCGGTGCCCCAGGGCGACCTGCTGGGACTGGTGGCGTTC
TTCGTCTTCGCCAGCCTCACCGTGGCCAGCGTGCTCTGCCAGGTGCTGTTCTCCTTCCTG
GCCCGCGGGGTTCCCTTCCGCGTCTGGTTCGGGGCCGCGGTGGCCTTCGGACTGCTCGCC
GGCACCACCGTCTGCCTCTTCGCCGATCCGGTGCTCGGCGCCCTGGACGGTCACTTCCTG
CAGATCACCACGCTCACCTGCCTCTACGGCTTCGTGATCGTGGCCTCCATGGCGGCGTTC
CAGGCGCTGCTCGGGCTCCCGGGCATTCCGCTCGGTGCGCTGACGCTGCTGCCGTTCGGC
ATCGGTACCTCGGGCGGGACGGTGCACCCGGACTTCCTGCCCAACTTCTACCGTCAGATC
AGCCCCTACATGGCCTCCTCCGCGGAGGTCGGCGGGCTCCGGGGGATCGCCTACATGGAC
GGCTCCGGGGTCGGCAGGTCCTTCCTGGTGCTGGGCATCTGGGCCGTGGTCGCGCTGCTG
CTCGTGGGGCTCGGCGGCATGCTGAAGGCCCGTCGTGCGGGCGGCGCGGCGAGTGCCGAC
CCGTCCGGCCGGAAGAACGGCCGGGTGGCCGCTCCCAGCGCCGTCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro No significant hit
SignalP
 [1-1]  Signal-anchor
Eukaryota   
TMHMM
 [24-46]  Transmembrane (i-o) [157-179]  Transmembrane (o-i) [186-208]  Transmembrane (i-o) [218-240]  Transmembrane (o-i) [242-264]  Transmembrane (i-o) [304-326]  Transmembrane (o-i)
Transmembrane 6